(data stored in ACNUC7421 zone)

EMBL: CP002343.PE99

CP002343.PE99        Location/Qualifiers
FT   CDS_pept        107605..108330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0099"
FT                   /product="hypothetical protein"
FT                   /note="COGs: COG4947 conserved hypothetical protein; KEGG:
FT                   dfe:Dfer_4768 hypothetical protein; SPTR: Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46661"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFC3"
FT                   /protein_id="ADU46661.1"
FT                   /translation="MKTTDRWYSDRLQTDLTLARWGTYGVPVLLFPSAGGDAEEVERFE
FT                   MVAHLRPLIDAGRAKIYSCDSVAGRAMMDRVGTPDHRLALFNAFHQAVAEEVIPAIHSD
FT                   SGGKLPVVVAGASIGAFNSLALICRYPHLIDSAVCMSGTYAIEKFIGGRFTDDLYFSSP
FT                   LHFLPGLDGPVLEALRQRMVIFASGSGEWEDVGESWRAAEVLGAKGVPHRVDDWGPDYK
FT                   HDWPTWWEMLPMYLDDLLP"
     atgaagacga cggaccggtg gtactccgac cgactgcaga ccgacctcac cctggcgcgc        60
     tggggcacgt acggcgtgcc cgtgctgctc ttccccagtg cgggcggcga cgccgaggag       120
     gtcgagcggt tcgagatggt cgcccacctg cgcccgctca tcgacgccgg gcgagccaag       180
     atctactcgt gcgacagcgt cgccggtcgg gccatgatgg accgggtcgg cacccccgac       240
     caccgcctgg cactcttcaa cgccttccac caggcggtcg ccgaggaggt catcccggcc       300
     atccacagcg actccggcgg gaagctgccg gtcgtcgtcg caggggcgtc gatcggggcg       360
     ttcaactcgc tggcgctgat ctgccgctac ccccacctca tcgactcggc cgtctgcatg       420
     agcggcacct acgcgatcga gaagttcatc ggcgggcgct tcaccgacga cctctacttc       480
     agctcgcccc tccacttcct gcccggcctc gacgggccgg tcctcgaggc cctgcggcaa       540
     cggatggtga tcttcgcctc gggcagcggc gaatgggagg acgtcggcga gtcgtggagg       600
     gcagccgagg tgctcggagc gaagggcgtc ccccaccgcg tggacgactg ggggcccgac       660
     tacaagcacg actggcccac gtggtgggag atgctgccga tgtacctcga cgacctcctg       720
     ccctga                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page