(data stored in ACNUC30630 zone)

EMBL: CP002344.PE10

CP002344.PE10        Location/Qualifiers
FT   CDS_pept        complement(14220..14489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0010"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR020390; KEGG: pth:PTH_1815 hypothetical
FT                   protein; SPTR: Hypothetical membrane protein; PFAM: Protein
FT                   of unknown function (DUF2619)"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50135"
FT                   /db_xref="GOA:E6SKE8"
FT                   /db_xref="InterPro:IPR020390"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKE8"
FT                   /protein_id="ADU50135.1"
FT                   /translation="MVSPNPYVAGMALTRVLSGSLEVLAAVLIWRYGRVDRALEINALL
FT                   AGAGPLAMMLATTIGLAGLAGSVPPLKLALILAGVALILIGTRI"
     atggtgtccc ccaaccccta tgtcgccggc atggcgttga cccgagtgct gtccggcagc        60
     ctggaagtgc tggccgccgt gttgatctgg cggtacggcc gcgtggatcg cgcgttggaa       120
     atcaacgcgt tgctcgccgg ggccggcccg ctggccatga tgctggccac gaccatcggc       180
     ctggccggac tggccggctc cgtccccccg ttgaagctgg cgctgatcct ggccggtgtg       240
     gccctgatcc tcatcggcac ccgaatctga                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page