(data stored in ACNUC30630 zone)

EMBL: CP002344.PE108

CP002344.PE108       Location/Qualifiers
FT   CDS_pept        109548..109772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0108"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spe:Spro_3116 binding-protein-dependent
FT                   transport systems inner membrane component; SPTR:
FT                   Transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50233"
FT                   /db_xref="GOA:E6SL31"
FT                   /db_xref="UniProtKB/TrEMBL:E6SL31"
FT                   /protein_id="ADU50233.1"
FT                   /translation="MDGELGTLLMKLVLALVGGGLTIVGLAGIIQGSLSSLRVPNRVVA
FT                   TVVFIVGLALVTIFGEPDLVTKIMGAMGE"
     gtggacggcg agctggggac gctgctgatg aagctggtgc tggcgctggt gggcggcggg        60
     ctgaccatcg tcggtttggc cgggatcatc cagggctcgc tgagcagcct gcgcgtgccc       120
     aaccgggtcg tggccacggt ggtcttcatc gtggggctgg ccctggtgac catcttcggg       180
     gagccggacc tggtcacgaa gatcatgggc gccatggggg agtga                       225
//

If you have problems or comments...

PBIL Back to PBIL home page