(data stored in ACNUC30630 zone)

EMBL: CP002344.PE113

CP002344.PE113       Location/Qualifiers
FT   CDS_pept        complement(113641..114042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0113"
FT                   /product="SUF system FeS assembly protein, NifU family"
FT                   /note="COGs: COG0822 NifU homolog involved in Fe-S cluster
FT                   formation; InterPro IPR002871: IPR011341; KEGG:
FT                   ttr:Tter_1695 SUF system FeS assembly protein, NifU family;
FT                   PFAM: nitrogen-fixing NifU domain protein; SPTR: SUF system
FT                   FeS assembly protein, NifU family; TIGRFAM: SUF system FeS
FT                   assembly protein, NifU family; PFAM: NifU-like N terminal
FT                   domain; TIGRFAM: SUF system FeS assembly protein, NifU
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50238"
FT                   /db_xref="GOA:E6SL36"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="UniProtKB/TrEMBL:E6SL36"
FT                   /protein_id="ADU50238.1"
FT                   /translation="MGSDFYRENILDHYRNPRNRGTLEGAQIRHEDMNPLCGDQVRFEV
FT                   RLDDGGRVEAAAFDGRGCAISQASASMLTEAVQGKTLDEIKTMDKDDVLAMLGIPLSPV
FT                   RLKCALLALKVLQAGIYRYEAEHAGGREA"
     gtgggcagcg atttctaccg ggagaacatc ctggaccact accgcaaccc gcgcaaccgc        60
     ggcaccctgg agggggcgca gatccggcac gaggacatga accccctctg cggcgatcag       120
     gtgcgcttcg aggtacgcct ggacgacggg ggccgggtcg aagcggccgc ttttgacggc       180
     cgcggctgcg ccatcagcca ggcgtcggcc tccatgctca ccgaggccgt tcagggcaag       240
     acgctggacg agatcaagac gatggacaag gacgacgtcc tggccatgct cggcatcccc       300
     ttgagccccg tccggctcaa gtgcgccctg ctggcgctga aggtcctgca ggcggggatc       360
     taccggtacg aggcggaaca cgcgggtggg cgcgaagcgt ga                          402
//

If you have problems or comments...

PBIL Back to PBIL home page