(data stored in ACNUC30630 zone)

EMBL: CP002344.PE119

CP002344.PE119       Location/Qualifiers
FT   CDS_pept        119834..120211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0119"
FT                   /product="succinate dehydrogenase subunit D"
FT                   /EC_number="1.3.5.1"
FT                   /note="COGs: COG2142 Succinate dehydrogenase hydrophobic
FT                   anchor subunit; KEGG: tro:trd_0332 succinate dehydrogenase,
FT                   membrane subunit; SPTR: Succinate dehydrogenase, membrane
FT                   subunit; PFAM: Succinate dehydrogenase/Fumarate reductase
FT                   transmembrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50244"
FT                   /db_xref="GOA:E6SL42"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:E6SL42"
FT                   /protein_id="ADU50244.1"
FT                   /translation="MSYGEGSPRPASGFELWSWFFMRISGLLLVFLVLGHLYIMHILNS
FT                   VEIIDYNFVARRWANIGWRTYDWVMLALALFHGANGIRVIIDDYAHRPGWRTFWLALLY
FT                   VVTFILLVLGTVVLVTFPFPA"
     gtgtcgtacg gagaaggaag cccgcgcccg gccagcgggt tcgagctgtg gtcctggttc        60
     ttcatgcgga tctccggcct gctgctggtc tttctcgtcc tggggcacct ctacatcatg       120
     catatcctca acagcgtgga aatcatcgac tacaacttcg tcgcccggcg ctgggccaac       180
     atcggctggc gcacctacga ctgggtgatg ctggccctgg cgctcttcca tggggccaac       240
     gggatccggg tcatcatcga cgactacgcc caccggccgg gatggcgcac cttctggctg       300
     gcgctgctct acgtggtgac gttcatcctg ctggtcctgg gcaccgtggt cctggtgacc       360
     ttcccgttcc cggcctga                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page