(data stored in ACNUC30630 zone)

EMBL: CP002344.PE130

CP002344.PE130       Location/Qualifiers
FT   CDS_pept        134180..134935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0130"
FT                   /product="3'-5' exonuclease, PolB"
FT                   /note="InterPro IPR019288; KEGG: hoh:Hoch_5692 3'-5'
FT                   exonuclease, PolB-like protein; PFAM: 3'-5' exonuclease,
FT                   PolB-like; SPTR: Putative uncharacterized protein; PFAM:
FT                   Predicted 3'-5' exonuclease related to the exonuclease
FT                   domain of PolB"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50255"
FT                   /db_xref="GOA:E6SL53"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR019288"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E6SL53"
FT                   /protein_id="ADU50255.1"
FT                   /translation="MSQPTPLAVDIETVGCEWDDLHPEVQDYLLRRARDDERDKVKDQL
FT                   ALHPGTGRVVAIALWRPYEDRGGVLVADPSATESRWTRFAGVDGDAQIYRGSERDILVE
FT                   FWRYVSQHAGTLITYNGRAFDGPFLMIRSAILGVTPTRNLVPYRYSFQDHCDLAEVLSF
FT                   HGARQRNSFLFWCHQFGIPSPKQEMDGAAVGAAYRAGRIDDIARYCLADARATAELYRR
FT                   LEPMIAVMDGRPPAVEPGTPGNPGGGRPA"
     gtgtcacaac cgacgccgct ggccgtcgac atcgaaaccg tcggctgcga atgggacgac        60
     ctgcaccccg aggtccagga ctacctgttg cgccgggcgc gggacgacga acgggacaag       120
     gtcaaggacc agctggcctt gcaccccggc acgggccgcg tggtcgccat cgccctctgg       180
     cggccctacg aggatcgcgg gggcgtgctg gtcgccgacc cgtcggccac cgagtcccgc       240
     tggacccgat tcgccggcgt cgacggcgat gcccagatct accgcggcag tgagcgggat       300
     atcctggtcg agttctggcg ctacgtgagc cagcatgcgg gtaccctgat cacctacaac       360
     ggccgtgcct tcgacggccc gttcctcatg atccggtcgg ccatcctggg cgtcacgccc       420
     acccgcaacc tggtgcccta ccggtacagc ttccaggacc actgcgacct ggcggaggtc       480
     ctgtccttcc acggggcgcg ccagcgcaac tccttcctat tttggtgcca ccagttcggg       540
     atcccctcgc ccaagcagga gatggacggg gcggcggtgg gcgccgccta ccgggccggg       600
     cggatcgacg acatcgcccg ctactgcctg gccgacgccc gggccacggc cgagctctac       660
     cggcgcctcg agccgatgat cgccgtcatg gacggccgcc cgcccgcggt cgagccgggc       720
     accccgggca acccgggcgg ggggcggccc gcttga                                 756
//

If you have problems or comments...

PBIL Back to PBIL home page