(data stored in ACNUC30630 zone)

EMBL: CP002344.PE135

CP002344.PE135       Location/Qualifiers
FT   CDS_pept        144207..146039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0135"
FT                   /product="polynucleotide adenylyltransferase/metal
FT                   dependent phosphohydrolase"
FT                   /note="COGs: COG0617 tRNA nucleotidyltransferase/poly(A)
FT                   polymerase; InterPro IPR002646: IPR006674: IPR006675; KEGG:
FT                   sth:STH1054 putative RNA nucleotidyltransferase; PFAM:
FT                   Polynucleotide adenylyltransferase region; metal-dependent
FT                   phosphohydrolase HD sub domain; SPTR: Putative RNA
FT                   nucleotidyltransferase; TIGRFAM: metal dependent
FT                   phophohydrolase; PFAM: HD domain; Poly A polymerase head
FT                   domain; TIGRFAM: uncharacterized domain HDIG"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50260"
FT                   /db_xref="GOA:E6SLJ3"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR032810"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLJ3"
FT                   /protein_id="ADU50260.1"
FT                   /translation="MGDGQATRQREEKLQRRQRERQQLEATRRTLSRLLAITRRCRTGE
FT                   EFARALTALWAQETRFGGEPDPGAPAEPAAVPAGNLPAGTRPEGPAGGPGDEPAGREGA
FT                   DGTPPGEERDPRRGGPGGGAAAVRALAALPPGQRPAELARRFDRLVPAPVREVLTRLGE
FT                   HGHAAYLVGGCVRDLLMARPPKDWDVATSARPEEVRRIFPRTIPTGIEHGTVTVRARGL
FT                   SVEVTTFRQESGYSDFRHPDRVEFTRDLRADLERRDLTINAMALDAEGRLHDPLGGLAD
FT                   LEAGVVRAVGDPDERFREDALRLLRVVRFAARFGYRVEPRTEAALARCAPLIRHVSWER
FT                   IREEMSGLLVSPRPAWGLELLRTSGLLEPIWPELLEGVGVAQNVHHAYTVWEHNLLACQ
FT                   YTPPVLRLRLAGLLHDVGKPRTVSVDARGQRHFYHHEVVGADMARQMLRRLKFDNDTVR
FT                   HVAHLVRHHLALHHYPGMTDAAIRRLIQRIGFDYLEDLIILRVADRAASGTKRAPISRG
FT                   AYRLLTRMEKILEQDAAFSLHDLAIDGHDVMAATGLGPGPAIGWILQKLLEDVLDEPGR
FT                   NRRQWLMERAAELRAEAEARFGGGRRAGTPAGGA"
     atgggcgacg ggcaggccac ccgccagcgg gaggaaaagc tgcagcggcg gcagcgggag        60
     cggcagcaac tggaggcgac ccggcgcacg ttgagccgcc tgctggccat cacccgccgc       120
     tgccgcacgg gggaggagtt cgcccgtgcc ctgacggccc tgtgggccca ggagacccgt       180
     ttcggaggcg agccggaccc gggcgccccg gccgagccgg cggctgtacc ggcggggaac       240
     ttgcccgcag ggacccggcc ggagggaccg gcggggggcc cgggggacga gccggcggga       300
     cgggaagggg ctgacggcac gccccccggc gaggagcggg atccccgccg cggcgggccc       360
     ggcggtggag ccgctgccgt acgcgccctg gccgccctgc cgccggggca gcgccccgcg       420
     gagctggcgc gccggttcga ccggctggtg cccgccccgg tgcgggaggt cctgacccgg       480
     ctgggcgagc acggccacgc cgcctacctg gtgggcggct gcgtccggga cctactgatg       540
     gcgcgcccgc ccaaggactg ggacgtggcc acctctgccc ggcccgaaga ggtgcgccgg       600
     atcttccccc gcaccatccc cacgggcatc gagcacggca ccgtcaccgt ccgcgcgcgg       660
     ggcctgagcg tggaggtgac caccttccgc caggagtcgg ggtacagcga cttccgccac       720
     cccgaccggg tggagttcac ccgtgacctg cgggccgatc tggagcggcg cgacctgacg       780
     atcaacgcca tggccctgga tgccgagggg cggctgcacg accccctggg cggtctggcc       840
     gacctggaag cgggcgtggt ccgggccgta ggcgatcccg acgagcgctt ccgcgaggac       900
     gccctgcggc tgctgcgggt ggtgcgcttc gccgcccgct tcgggtaccg ggtggagccg       960
     cgtaccgagg cggccctggc ccgttgcgcc cccctgatcc gccacgtctc ctgggagcgc      1020
     atccgcgagg agatgtccgg cctgctggtc agcccgcggc ccgcctgggg gctggagctg      1080
     ctgcgcacca gcggcctgct ggagcccatc tggcccgagc tgctggaagg cgtcggcgtg      1140
     gcccagaacg tccaccacgc ctacaccgtg tgggaacaca acctgctggc atgccagtac      1200
     acgccgccgg tgctgcgcct gcgcctggcg ggcctcctgc acgacgtggg caagccgcgc      1260
     accgtgtccg tcgatgcccg gggccagcgc cacttctacc accacgaggt ggtgggggcc      1320
     gacatggccc ggcagatgct gcggcggctg aagttcgaca acgacaccgt gcgccacgtg      1380
     gcgcacctgg tgcgccacca cctggcgctt caccactacc cgggcatgac cgatgccgcc      1440
     atccggcggc tgatccagcg catcggcttc gactacctgg aagacctgat catcctgcgg      1500
     gtggccgacc gcgccgcctc gggcaccaag cgggcgccca tctcccgcgg cgcctaccgg      1560
     ctgctgaccc gcatggagaa gatcctggag caggacgccg ccttcagcct gcacgacctg      1620
     gccatcgacg gccacgacgt catggcggcc acgggcctgg ggccgggccc cgccatcggc      1680
     tggatcctcc agaagctgct ggaggacgtg ctggacgaac ccggccgcaa ccggcgccag      1740
     tggctgatgg agcgggcggc ggaactgcgg gcggaggcgg aggcccgttt cggcgggggg      1800
     cgcagggctg gcaccccggc gggcggcgcc tga                                   1833
//

If you have problems or comments...

PBIL Back to PBIL home page