(data stored in ACNUC30630 zone)

EMBL: CP002344.PE136

CP002344.PE136       Location/Qualifiers
FT   CDS_pept        146076..147572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0136"
FT                   /product="peptidase M24"
FT                   /note="COGs: COG0006 Xaa-Pro aminopeptidase; InterPro
FT                   IPR000587: IPR000994: IPR001131: IPR001714; KEGG:
FT                   rca:Rcas_4452 peptidase M24; PFAM: peptidase M24;
FT                   creatinase; SPTR: Peptidase M24; PFAM: Metallopeptidase
FT                   family M24; Creatinase/Prolidase N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50261"
FT                   /db_xref="GOA:E6SLJ4"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLJ4"
FT                   /protein_id="ADU50261.1"
FT                   /translation="MAADIGSGDGGKQGFGKVEGPGGGGGEPGAGRPHARGALRRGDVA
FT                   RAEVAARAQDAGPAAAKRATGHSPGDDGPAPQGPQVPQAARLAALQERMADAGIDLVVL
FT                   TPGTSWFYLAGMNLLGSRLSLLLVPRRGEPAWVAPLLEAERVAEAPLARALGRSAGRVC
FT                   TYADGEDPAPAVARAVALATAGLGGPPRVAAMEERVARLFEWRAASAALPGVAWQPAEP
FT                   LLVALRARKDLAEVAAIRRAAELVETALGHAMAFVQPGYRESQIAREMEKALRELGTRS
FT                   PFGIHVASGPRSAVPHAETEDRVLQPGDLVWIDVGAEVDGYAADITRTFLLPGGDPGEA
FT                   ARKAAIYRVCYLAQAAARAAARPGVRAGDVDAAARRVIEEAGYGPYFTHRTGHGLGLDV
FT                   HEAPNIAPGDATLLEPGMVFTVEPGIYLPGLGGVRIEDDMLITEDGAVSLTRSRRWFAP
FT                   GPEPVLVAGPAGSPRPAGPGPAWQPGGTGAGPGGTGEGGR"
     gtggcggcgg acatcggcag cggcgacggc gggaagcagg gattcggcaa ggtagagggc        60
     cctggcggcg ggggcggtga accgggtgcc gggcggccgc atgcgagggg cgcactccgc       120
     aggggggacg tggcaagggc ggaggttgcg gcaagggctc aggacgccgg tccggcggcg       180
     gcgaagcggg ccacgggaca ctcgcccggg gatgacgggc cggcgccgca ggggccccag       240
     gttccccagg cggcacgact cgccgccctg caggaacgca tggccgacgc gggcatcgac       300
     ctggtggtgc tcacgccggg gaccagctgg ttctacctgg cggggatgaa cctgctgggg       360
     agtcgcctga gcctgctgct ggtaccccgg cggggggagc cggcgtgggt ggcgcccttg       420
     ttggaggcgg agcgggtggc ggaggcaccc ctggcccggg ccctgggccg gagcgccggc       480
     cgggtgtgca cctacgccga cggggaagac ccggcgcccg cggtggcccg ggcggtggcc       540
     ctggccaccg cggggctcgg gggaccgccg cgggtggccg ccatggagga gcgggtggcg       600
     cgcctcttcg aatggcgggc cgccagcgcc gccctgcccg gggtggcgtg gcagcccgcc       660
     gagccgctgc tggtggccct gcgagcccgc aaggacctgg cggaagtggc ggccatccgc       720
     cgggcggcgg aactggtcga gaccgccttg ggccacgcca tggccttcgt ccagcccggc       780
     taccgggaaa gtcagattgc ccgggaaatg gagaaggcgc tccgggaact gggaacccgc       840
     agccccttcg gcatccacgt ggcatcgggc ccgcgctcgg cggtacccca tgccgagacc       900
     gaggaccggg tgctgcagcc gggcgacctg gtctggatcg acgtgggggc ggaggtggac       960
     ggctacgccg ccgacatcac ccgcaccttc ctcctgccgg ggggcgatcc gggcgaggcg      1020
     gcccgcaagg cggcgatcta ccgggtttgc tacctggccc aggcggcggc ccgcgctgcg      1080
     gcgcggccgg gggtccgggc cggcgacgtg gacgcggcgg cccggcgggt gatcgaggag      1140
     gcgggctacg gcccctactt cacccaccgc accggccacg gcctggggct ggacgtccac      1200
     gaggcgccca acatcgcgcc gggggacgcc accctgctgg agccgggcat ggtgttcacg      1260
     gtggagcccg gcatctacct gcccggtctg ggcggtgtgc gcatcgaaga cgacatgctg      1320
     atcaccgaag atggtgccgt cagccttacc cgctcccggc gctggttcgc tccggggccc      1380
     gagccggtcc tcgtggccgg tccagccggc tcgccgcggc ccgccgggcc gggtccggct      1440
     tggcagcccg gcggcaccgg ggcgggcccc ggcggcacgg gggagggcgg ccggtga         1497
//

If you have problems or comments...

PBIL Back to PBIL home page