(data stored in ACNUC30630 zone)

EMBL: CP002344.PE148

CP002344.PE148       Location/Qualifiers
FT   CDS_pept        166422..167153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0148"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sco:SCO2669 hypothetical protein; SPTR: Major
FT                   ampullate gland dragline silk protein-1"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50273"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLK6"
FT                   /protein_id="ADU50273.1"
FT                   /translation="MVPGVTVAYLEGFRWVLEGTLVDAGREDGRLSVRLDPGALTGPGG
FT                   VGAGNVAPGGAGADAGTGAPARSDRPGPGGRQAPGPDAGRGGRAVVPRPASPWEPAGTG
FT                   GATQASGPAGIAITADGVVTLGVEPGAPVTINGRDAAAGALRAGDRVTIFLRRSSGTVR
FT                   RVEATRAAVTGRVESVDALRGVLEVRAGFGRGRWVVDGAALVRRNGRDARLADLRPGDA
FT                   IRLGLRGPGVASYVEAESVLP"
     atggtgcccg gggtaacggt ggcgtacctc gaagggttcc gctgggtgct cgaagggacg        60
     ctggtcgacg ccggccggga ggacggccgc ctgtccgtgc gcctggaccc gggtgccctc       120
     actggccccg ggggtgtcgg ggctggaaac gtcgcccctg ggggcgcagg ggcggacgcg       180
     ggcaccgggg ccccggcccg gtccgaccgg cccgggccgg gtgggcggca ggcgccgggg       240
     cccgatgcgg gtcgcggggg tcgggcggtg gtgccacgcc ccgcgagccc ctgggagccg       300
     gccggaacgg gcggggccac ccaggcgtcc ggcccggcgg gtatcgccat cacggcggac       360
     ggggtcgtca cgctcggggt cgaaccgggc gcgccggtga ccatcaacgg gcgagatgcg       420
     gcggccggcg ccctgcgggc gggagaccgg gtcacgatct tcctgcgccg gtcgtcgggc       480
     acggtgcgcc gggtggaagc gacccgggcg gcggtgacgg gccgggtcga atccgtcgat       540
     gccctgcgcg gcgtgttgga ggtgcgcgcc ggcttcgggc gggggcgctg ggtggtcgac       600
     ggtgctgccc tggttcgccg caacggccgg gacgcacgcc tggccgacct gcggccgggc       660
     gacgccatcc ggctgggctt gcggggcccg ggcgtggcga gttacgtgga ggccgagagc       720
     gtcctcccgt ag                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page