(data stored in ACNUC30630 zone)

EMBL: CP002344.PE152

CP002344.PE152       Location/Qualifiers
FT   CDS_pept        175594..176433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0152"
FT                   /product="Peptidase M23"
FT                   /note="COGs: COG0739 Membrane protein related to
FT                   metalloendopeptidase; InterPro IPR016047; KEGG:
FT                   ade:Adeh_1347 peptidase M23B; PFAM: Peptidase M23; SPTR:
FT                   Peptidase M23B; PFAM: Peptidase family M23"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50277"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLL0"
FT                   /protein_id="ADU50277.1"
FT                   /translation="MATGDRWLQRVNALLLAAWLGMVAAHVSGRDGDPAARPAPGKGGW
FT                   FAPVPGFTRLFATERPGPASPQVEPAAAGAGAAPAARGEGEEAASGKPGGADRAGAVRQ
FT                   DGAAPGSSPWSIPPAVSWARPLDAVATVTSLFGPRDGRWHHGVDLAVPAGTAVRSVWQG
FT                   TVRQAGWRGAYGLAVEVAHPGGWSTLYGHLASVAVEPGQRVARGQLLGRVGATGRATGP
FT                   HLHLEVRVPEGFFDPLAWLDRRWYRWAVGAGDGDAVGTAAVAAPGGAATGSGAAGGE"
     ttggcaaccg gcgaccgatg gcttcagcgc gtcaacgccc tgctcctggc cgcctggctg        60
     ggcatggtgg cggcccacgt gtccgggcgg gatggggacc ccgcggcccg tcccgcgccc       120
     ggcaaggggg ggtggttcgc gcccgtccca gggttcaccc gtctttttgc gacggagcgg       180
     cccggtccgg cctctccgca ggtcgaaccg gccgcggccg gtgccggggc ggcgccggcc       240
     gcgcggggtg agggggagga ggccgcgagc gggaagcccg gcggcgcgga ccgcgccggg       300
     gcggtgcggc aggatggcgc cgcgccgggt tcgtccccct ggtccatccc gccggccgtt       360
     agctgggcac gtcccctgga cgccgtcgcc accgtgacct cgctcttcgg gccgcgggac       420
     ggccgctggc accatggcgt ggacctggcg gtaccggccg gcacggcggt gcggtccgtc       480
     tggcagggta ccgtccggca ggcgggctgg cggggcgcct acggcctggc ggtggaggtg       540
     gcccatcccg gcggctggag caccctctac ggtcacctgg cgtcggtggc cgtcgagccc       600
     ggccagcggg tggcccgtgg ccagctcctc gggcgggtgg gcgccacggg ccgcgccacg       660
     ggaccccacc tgcacctgga ggtgcgggtg ccggaggggt tcttcgaccc cctggcctgg       720
     ctggatcgcc gctggtaccg gtgggcggtg ggggcggggg acggtgacgc cgtcgggacc       780
     gccgcggtgg cggcgcccgg cggtgcggcc accggcagcg gtgcggccgg cggcgagtga       840
//

If you have problems or comments...

PBIL Back to PBIL home page