(data stored in ACNUC30630 zone)

EMBL: CP002344.PE153

CP002344.PE153       Location/Qualifiers
FT   CDS_pept        176556..176795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0153"
FT                   /product="LSU ribosomal protein L31P"
FT                   /note="COGs: COG0254 Ribosomal protein L31; InterPro
FT                   IPR002150; KEGG: aac:Aaci_2781 ribosomal protein L31; PFAM:
FT                   ribosomal protein L31; SPTR: 50S ribosomal protein L31;
FT                   TIGRFAM: ribosomal protein L31; PFAM: Ribosomal protein
FT                   L31; TIGRFAM: ribosomal protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50278"
FT                   /db_xref="GOA:E6SLL1"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLL1"
FT                   /protein_id="ADU50278.1"
FT                   /translation="MKPGIHPEYKRTTITCACGAVYEVGSTKENLRVDVCARCHPFYTG
FT                   TQRIVDTGGRVDRFRQKYERYRQGQEQAASGAGR"
     atgaagccgg gcattcatcc cgagtataag cgcaccacca ttacctgtgc ctgcggagcc        60
     gtctacgagg taggctccac caaggagaac ctgcgggtcg acgtgtgcgc ccggtgccat       120
     cccttctaca ccgggaccca gcgcatcgtc gacaccggcg gccgcgtcga ccggttccgc       180
     cagaagtacg agcggtaccg ccaggggcag gaacaggcgg cttccggcgc cggccgctga       240
//

If you have problems or comments...

PBIL Back to PBIL home page