(data stored in ACNUC30630 zone)

EMBL: CP002344.PE157

CP002344.PE157       Location/Qualifiers
FT   CDS_pept        180058..181218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0157"
FT                   /product="translation factor SUA5"
FT                   /note="COGs: COG0009 Putative translation factor (SUA5);
FT                   InterPro IPR006070: IPR005145: IPR004388: IPR010923; KEGG:
FT                   ape:APE_2397 putative translation factor; PFAM:
FT                   SUA5/yciO/yrdC domain; SUA5 domain-containing protein;
FT                   SPTR: Putative translation factor; TIGRFAM:
FT                   Sua5/YciO/YrdC/YwlC family protein; PFAM: yrdC domain; SUA5
FT                   domain; TIGRFAM: Sua5/YciO/YrdC/YwlC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50282"
FT                   /db_xref="GOA:E6SLL5"
FT                   /db_xref="InterPro:IPR005145"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR010923"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR038385"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLL5"
FT                   /protein_id="ADU50282.1"
FT                   /translation="MAGMTPAPAAWVRLGADPERDAAAIRHAGAVLRRGGLVAFPTETV
FT                   YGLGADALNAQAVVRIFAAKGRPADNPLIVHVTGPEMAGPAVVAAWPDAARRLVDRFWP
FT                   GPLTLVLPAGPAVPAAVRAGLPTVAVRCPAHPVAQALIAAAGTPVAAPSANRSGRPSPT
FT                   RAGDVWADLGPHLDVLLDAGPVPVGVESTVVDVTTWPPRLLRPGGLPVEDLERALGVAL
FT                   APPPRLEAASAAPAPGMKYRHYAPEAPVMLVDEPAAGVEPVRRWLAAGQRVALVGCRED
FT                   LEALLDRAGLAAAWPDPWDERAGAGGADDPSPVVALDLGPRARPDEQARRLFRALRAAD
FT                   AAGATRILALAVPEVGLGRAVMNRLRKAAAGGEVPDGDHSHGAGRL"
     atggccggca tgacgccagc gccggcggcc tgggtccggc tgggtgccga cccggagcgg        60
     gacgccgcgg ccatccggca cgcgggcgcc gtcctgcggc ggggcgggct ggtggctttc       120
     cccaccgaga cggtgtacgg cctgggggcc gacgccctga acgcccaggc ggtggtgcgg       180
     atcttcgccg ccaagggccg gccggcggac aacccgctga tcgtgcacgt gacaggaccc       240
     gagatggcgg ggccggcggt ggtcgccgcg tggcccgatg ctgcgcgccg cctggtggac       300
     cgcttctggc cggggccgct caccctggtg ctgccggcgg gcccggccgt ccccgccgcg       360
     gtgcgggcgg gcctgcccac cgtggcggtg cgctgccccg cccaccccgt ggcccaggcc       420
     ttgatcgccg ccgcgggcac gcccgtggcc gcacccagcg ccaaccgctc gggccgcccc       480
     agcccgaccc gggccggcga cgtctgggcc gacctgggtc ctcatctgga cgtgctgctg       540
     gacgcggggc ccgtccccgt gggcgtggag agcacggtgg tcgacgtcac cacctggccg       600
     ccgcgcctct tgcggcccgg gggcctgccg gtggaagacc tggagcgggc gctgggcgtg       660
     gccctggcgc cgcccccccg gctcgaggca gcgtcggcgg caccggcccc cggcatgaag       720
     taccgccact acgcccccga agcgccggtg atgctggtgg acgaacccgc cgccggcgtg       780
     gaacccgtgc gccgctggct ggccgccggc cagcgggtgg ccctggtggg ttgccgggaa       840
     gacctggagg cgctgctgga ccgggcgggc ctcgccgccg cctggccgga tccgtgggac       900
     gaacgggcgg gcgccggcgg ggccgatgat ccctcacccg tcgtggccct ggatctcggc       960
     ccgcgggccc ggccggacga gcaggcgcgc cggctcttcc gcgccctgcg ggcggccgac      1020
     gccgccggcg caacccgcat cctggctctg gccgtgcccg aggtgggcct ggggcgcgcg      1080
     gtgatgaacc ggctgcgcaa ggcagcggca ggaggggagg tgcccgacgg tgaccattcg      1140
     cacggtgctg gtcgtctgta g                                                1161
//

If you have problems or comments...

PBIL Back to PBIL home page