(data stored in ACNUC30630 zone)

EMBL: CP002344.PE162

CP002344.PE162       Location/Qualifiers
FT   CDS_pept        185822..186148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0162"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cse:Cseg_3010 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50287"
FT                   /db_xref="GOA:E6SLM0"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLM0"
FT                   /protein_id="ADU50287.1"
FT                   /translation="MNHFTTWPDTTLGLVAGLWGLIWGAVNYRLIAGPVQRMATTDDGE
FT                   QIATLQQQVVARYLLRMALSFVSLLVVFWVTGRPVAILAALAGLLLAGDVPLFFLRRAR
FT                   RERA"
     gtgaatcatt tcacaacgtg gccggataca accctgggcc tggtggccgg cctgtggggc        60
     ctgatttggg gggcggtgaa ctaccgcctc atcgccgggc ccgtccagcg catggcgaca       120
     acggacgatg gcgagcagat tgccacactt caacagcagg tcgtggcccg atacttgttg       180
     cgcatggctt taagttttgt ttcactcttg gtggtgtttt gggtcaccgg ccggccggtg       240
     gccatccttg cggccctggc cgggcttctg ctggccggtg acgttcccct gttcttcctg       300
     aggcgagcaa ggagggaacg ggcttga                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page