(data stored in ACNUC30630 zone)

EMBL: CP002344.PE175

CP002344.PE175       Location/Qualifiers
FT   CDS_pept        197831..198844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0175"
FT                   /product="rod shape-determining protein MreB"
FT                   /note="COGs: COG1077 Actin-like ATPase involved in cell
FT                   morphogenesis; InterPro IPR004753; KEGG: adg:Adeg_1540 rod
FT                   shape-determining protein MreB; PFAM: cell shape
FT                   determining protein MreB/Mrl; SPTR: Cell shape determining
FT                   protein, MreB/Mrl family; TIGRFAM: cell shape determining
FT                   protein, MreB/Mrl family; PFAM: MreB/Mbl protein; TIGRFAM:
FT                   cell shape determining protein, MreB/Mrl family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50300"
FT                   /db_xref="GOA:E6SLN3"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLN3"
FT                   /protein_id="ADU50300.1"
FT                   /translation="MLGFVRDLGVDLGTVNTVVYVEGRGIVLNEPSVVAVDRETGHVLA
FT                   VGSEAHRMLGRTPGNIVAARPLRGGVIADFTATATLLKMLLKRAVPQRLGLRPRMVVCV
FT                   PSGVTTVERRAVIEAGYEAGARKVYLLEEPVAAALGAGLAIHEPGGHMVVDVGGGTTDI
FT                   AVLSLGGVVVATSTRTGGDTFDEAIVRYVKRQYNVLIGERTAEQAKIAIGTAVPPEGDG
FT                   ERFEVRGRDLVTGLPRTLHLSAAEVQQALEEPLAALLAALRGALERVPPELAADILHRG
FT                   LVLTGGGSLLRGLDRRIADATGLPVVRPEQPLLTVALGTGVALSRLDRLDGVLIAG"
     atgctcgggt tcgtccggga cctgggggtc gacctgggaa ccgtcaacac ggtggtgtat        60
     gtggaaggcc ggggcatcgt gctcaacgag ccgtcggtgg tggccgtcga ccgcgagacg       120
     ggccacgtcc tggccgtggg ttcggaagcc caccggatgc tgggccgcac gccggggaac       180
     atcgtggcgg cgcgtcccct gcggggcggg gtcatcgccg acttcacggc cacggccacg       240
     ctgctgaaga tgctgctcaa gcgggccgtt ccccaacggc tgggcttgcg gccccggatg       300
     gtggtctgcg tcccctcggg cgtgaccacc gtcgagcggc gggccgtcat cgaagcaggc       360
     tacgaggccg gcgcccgcaa ggtgtacctg ttggaagaac cggtggcggc cgccctgggg       420
     gcgggcctcg ccatccacga gcccggcggc cacatggtgg tcgacgtggg cggcgggacg       480
     acggacatcg ccgtgctctc cctgggcggg gtggtggtgg ccacctccac ccgcaccggc       540
     ggcgacacct tcgacgaggc catcgtccgc tatgtcaagc ggcagtacaa cgtgctgatc       600
     ggtgagcgca cggcggaaca ggcgaagatc gccatcggca ccgccgtccc ccccgagggc       660
     gacggggagc gcttcgaagt ccggggccgg gacctggtca cgggcctgcc ccgcaccctg       720
     cacctctccg ccgccgaggt gcagcaggcc ctggaagaac ccctggccgc gctcctggcc       780
     gccctgcgcg gcgccctgga gcgggtgcca ccggaactgg cggcggacat ccttcaccgc       840
     gggctggtgc tcaccggcgg cggctcgctg ctgcgcggcc tcgaccggcg catcgccgac       900
     gccaccggcc tgcccgtggt gcggccggag cagccgctct tgacggtggc cctgggcacc       960
     ggcgtcgccc tcagccggct ggaccggctg gacggggtcc tcatcgccgg atga            1014
//

If you have problems or comments...

PBIL Back to PBIL home page