(data stored in ACNUC30630 zone)

EMBL: CP002344.PE179

CP002344.PE179       Location/Qualifiers
FT   CDS_pept        202316..202771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0179"
FT                   /product="3-hydroxyacyl-(acyl-carrier-protein) dehydratase"
FT                   /EC_number="4.2.1.-"
FT                   /note="COGs: COG0764
FT                   3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein)
FT                   dehydratase; InterPro IPR013114: IPR010084; KEGG:
FT                   chl:Chy400_1555 (3R)-hydroxymyristoyl-ACP dehydratase;
FT                   PFAM: Beta-hydroxyacyl-(acyl-carrier-protein) dehydratase
FT                   FabA/FabZ; SPTR:
FT                   (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase;
FT                   TIGRFAM: beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabZ; PFAM: FabA-like domain; TIGRFAM:
FT                   beta-hydroxyacyl-[acyl carrier protein] dehydratase FabZ"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50304"
FT                   /db_xref="GOA:E6SLN7"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLN7"
FT                   /protein_id="ADU50304.1"
FT                   /translation="MTAQDRPQGAMDVQDILSVLPHRYPFLLVDRILELEPGRRAVGRK
FT                   CVSANEPYFQGHFPGRPIMPGVLILEAMAQVGAAAVLSMPENRGRLALFAGADRVRWRR
FT                   PVIPGDCLEIEVEIIAMRGPIGKGRARATVDGELAAEAELSFALRPA"
     gtgaccgcgc aggaccgccc ccagggcgcc atggacgtcc aggacatcct gagcgtgctg        60
     ccccaccgtt accccttcct gctggtcgac cggatcctgg aactggagcc gggacgccgg       120
     gccgtgggcc ggaagtgcgt cagcgccaat gagccctact ttcaaggcca cttccccggc       180
     cgccccatca tgccgggggt gctgatcctg gaagccatgg cccaggtggg ggccgctgcc       240
     gtgctctcca tgccggaaaa ccgcggccgc ctggcgttgt tcgccggcgc cgaccgcgtg       300
     cgctggcgcc gccccgtgat ccccggggac tgtctggaga tcgaggtcga aatcatcgcc       360
     atgcgcgggc ccatcggcaa gggccgcgcc cgtgccaccg tggacgggga gctggccgcc       420
     gaggcggagc tcagcttcgc cctgcggccg gcgtga                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page