(data stored in ACNUC30630 zone)

EMBL: CP002344.PE180

CP002344.PE180       Location/Qualifiers
FT   CDS_pept        203208..204464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0180"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="COGs: COG1098 RNA binding protein (contains
FT                   ribosomal protein S1 domain); InterPro IPR003029; KEGG:
FT                   rba:RB10524 putative RNA-binding protein; PFAM: RNA binding
FT                   S1 domain protein; SPTR: Putative uncharacterized protein;
FT                   PFAM: S1 RNA binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50305"
FT                   /db_xref="GOA:E6SLN8"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLN8"
FT                   /protein_id="ADU50305.1"
FT                   /translation="MSDGLKDSLLPGEDSPAPAPGGPSPVVEPVLPATTAADEPAGGRP
FT                   ARPAAEGRAGGSPPVPARRGVGPAEGTTAGTPYGYRSGLHRPASAFPRRTGGSGNESGT
FT                   RTGAGAGTGAGAAPGAGSGSAAGAAAGSGAEVRDLAGLVPLSPGTRVHGTITGIVGYGA
FT                   FLVTDDGRRGLIHISEISDWYVERAEDYFYKGERVQVEVVHFDPNSGKYAFSTRRLGGK
FT                   QPLANRYADRLLELHRHGIIRSGYKGWAREPGRWPWRGERRGGTGTASTPGPSGTAATG
FT                   SPGRTNRPAGRNKPGSRPAAGALAGTGQGAGPVGPGSRPGGSRDGTGQPAAGASQTPGA
FT                   RTAGPAAVQDDTDLLQLLRRHVGQVSPAARAELDRLVQAYGIARVGLVLAQVLEGMDRS
FT                   LQVVEAAGKRLAAGAGASA"
     atgtcggatg ggttgaagga ttccctattg cctggcgagg attccccagc cccggcgccc        60
     ggcggcccga gcccggtggt ggagccggtt cttcccgcca cgaccgctgc ggacgaaccg       120
     gccggcggcc gtccggcccg cccggcggcg gagggcaggg ccggcggatc gccgccggtg       180
     ccggcccggc ggggggtggg ccccgccgag ggcacgacag ccggcacccc ctacggatac       240
     cgctccggct tgcaccggcc ggcctcggcc ttcccccggc gaaccggcgg cagtggcaac       300
     gagagcggca ccaggaccgg ggccggtgcc gggacggggg caggggctgc gccaggggcc       360
     ggttcggggt cggctgcagg ggccgctgca ggctccggcg ccgaggtccg cgacctggcc       420
     gggctcgtcc ccctgtcgcc cgggacccgg gttcacggca ccatcaccgg gatcgtcggt       480
     tacggtgcct tcctggtgac cgacgacggc cgccgcggcc tgatccacat ctccgagatc       540
     tccgactggt acgtggagcg ggccgaggat tacttctaca agggcgagcg ggtgcaagtc       600
     gaggtcgtcc acttcgatcc caacagcggc aagtacgcct tctccacccg gcggctgggc       660
     ggcaagcagc ccctggccaa ccgctacgcg gaccggttgc tggagctgca ccggcacggc       720
     atcatccgat cggggtacaa ggggtgggcc cgcgagcccg gccggtggcc ctggcgcggg       780
     gaacgtcgcg gggggaccgg gacggcgagc accccgggtc catctggcac cgccgcgaca       840
     ggctcgcccg gccggacgaa ccggcccgcc ggccggaaca agccgggctc ccgcccggcc       900
     gcgggcgcct tggcgggtac cgggcaaggc gccggaccgg tgggccccgg gagccgcccc       960
     ggaggctcgc gcgacggcac cggccagccc gccgccgggg cctcccaaac ccccggtgcc      1020
     cgcaccgccg gtcctgccgc ggtgcaggat gacacggacc tgctgcagct cctgcgccgg      1080
     catgtgggcc aagtctcgcc cgcggcgcgg gcggagctgg accggctggt ccaggcctac      1140
     ggcatcgccc gggtgggcct cgtcctcgcc caggtcctgg agggcatgga ccggtcgctg      1200
     caagtggtcg aagccgctgg caagcggctg gcggccggcg ccggggcgtc ggcttga         1257
//

If you have problems or comments...

PBIL Back to PBIL home page