(data stored in ACNUC30630 zone)

EMBL: CP002344.PE184

CP002344.PE184       Location/Qualifiers
FT   CDS_pept        208123..208524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0184"
FT                   /product="flagellar protein FlaG protein"
FT                   /note="COGs: COG1334 Uncharacterized flagellar protein
FT                   FlaG; InterPro IPR005186; KEGG: cti:RALTA_B2129 FlaG:
FT                   flagellar protein; PFAM: flagellar protein FlaG protein;
FT                   SPTR: Flagellar protein; PFAM: FlaG protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50309"
FT                   /db_xref="InterPro:IPR005186"
FT                   /db_xref="InterPro:IPR035924"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLP2"
FT                   /protein_id="ADU50309.1"
FT                   /translation="MRTLTIPPQNPVAGGGFTAAGAGFAATNRTSSGRQVRDAGAMGGT
FT                   GAAGTVPGSAPAAAPAGSDTRTGPLQDLAPDPFGYRLQFHVDDATGRVVAQVVDRETGE
FT                   IVRQVPPEYVLRIAMYIEALLGQWLDRRG"
     gtgaggacct tgaccatccc accccagaat ccggtggccg gaggcgggtt cactgccgcc        60
     ggcgcggggt tcgccgcaac gaaccgcacg agttctggcc ggcaggtgcg ggacgccggc       120
     gccatgggcg gcaccggtgc ggcgggcacg gtgccgggta gcgccccggc agcggcgccc       180
     gccgggagcg atactcggac cgggcccctc caggatctgg ctcctgaccc cttcggctac       240
     cggctgcagt tccacgtgga cgacgccacg ggccgcgtgg tggcgcaagt ggtggaccgg       300
     gagacggggg agatcgtgcg gcaggttccc ccagaatacg tacttcgaat cgccatgtac       360
     attgaggcac tcctggggca gtggctggac cggcgaggat aa                          402
//

If you have problems or comments...

PBIL Back to PBIL home page