(data stored in ACNUC30630 zone)

EMBL: CP002344.PE189

CP002344.PE189       Location/Qualifiers
FT   CDS_pept        213813..214313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0189"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sth:STH119 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50314"
FT                   /db_xref="GOA:E6SLP7"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLP7"
FT                   /protein_id="ADU50314.1"
FT                   /translation="MGHDALWWALALLAAAGAAGIVGEMRASWRRRRRSRRSRRGEPSW
FT                   GPWPLVVLVRDAASFIEGFVDDLAALAPGSPIVVVDCGSADETASILQRLRQRVPTLQV
FT                   LRWPAARPGAPGPLEAALFVTGAPLALTIDLTNPAGWRWQDLRPPLLHLLEAFGSCRKS
FT                   MTG"
     atggggcatg acgcgctttg gtgggccctg gccctgctcg ccgcggcagg ggccgcgggc        60
     atcgtgggcg agatgcgggc atcgtggcgg cggagacgcc ggagccgccg gagccggcgc       120
     ggcgagccga gctggggccc ctggccgctg gtcgtcctgg tccgggacgc ggcgtccttc       180
     atcgaggggt tcgtggacga cctggccgcc ctggcgccgg gctcgcccat cgtggtggtc       240
     gactgcgggt ccgccgacga gacggcgtcc atcctgcagc ggttgcggca gcgggtcccc       300
     accctgcagg tgctgcgctg gccggcggcc cgcccgggag cccccggtcc gctggaagcc       360
     gccctgttcg tcacgggcgc gcccctggcg ctgaccatcg atctgacgaa ccccgccggc       420
     tggcggtggc aggatttgcg gccgccgctc ctccacctgc tcgaagcgtt cggatcttgc       480
     aggaaaagca tgacaggctg a                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page