(data stored in ACNUC30630 zone)

EMBL: CP002344.PE196

CP002344.PE196       Location/Qualifiers
FT   CDS_pept        221548..223134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0196"
FT                   /product="phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain I"
FT                   /note="COGs: COG1109 Phosphomannomutase; InterPro
FT                   IPR005844: IPR005845: IPR005846: IPR005843: IPR 016066:
FT                   IPR005841; KEGG: hau:Haur_2567 phosphoglucosamine mutase;
FT                   PFAM: phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain I;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain II; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain III;
FT                   phosphoglucomutase/phosphomannomutase; SPTR:
FT                   Phosphoglucomutase/phosphomannomutase family protein; PFAM:
FT                   Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha
FT                   domain III; Phosphoglucomutase/phosphomannomutase,
FT                   alpha/beta/alpha domain II;
FT                   Phosphoglucomutase/phosphomannomutase, C-terminal domain;
FT                   Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha
FT                   domain I; TIGRFAM: phosphoglucomutase, alpha-D-glucose
FT                   phosphate-specific"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50321"
FT                   /db_xref="GOA:E6SLQ4"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLQ4"
FT                   /protein_id="ADU50321.1"
FT                   /translation="MSDAPKIPHEAQQTAHPHHPPRTEPARDRATGEGTPAGTGDAGPA
FT                   PIRFGTDGWRAVIAEAFTFANVRRVAWALAEHLQATGRASQGVAVGYDCRFLSDRFAAT
FT                   VASVLAAAGIPVVLSRTACPTPALSWAVVSRKLGAGVMITASHNPPEYNGFKLKGWFGG
FT                   PALPDETRQLEAVLARQDATRPPGQEPPRGMDLDEARRRGRIEEADLIAPYTEQLRRLV
FT                   DWDRLRAARLRLVVDPMHGAARGVLAQMLREAGAEVTEIRGDWNPGFGGLAPEPIAPNL
FT                   GPAVEAVKSLGAQAVLVTDGDGDRVGAVDATGEVLDAQRIFALLLQHLVEVRGWTGSVV
FT                   KTFAGTRMVDKLAARYGLPFRETPIGFKHVCEYALKEDVLIGGEESGGIGIKNHMPERD
FT                   GLLCNLLLAEIMATRGCTLGQQVATLMAEIGPHYFQRRDLHLTPDGKNRLLRHLEEDPP
FT                   ARLAGWTVEKVDPLDGCKLIFGPSRWILFRASGTEPVVRVYAEAESPAEVETLLADGLR
FT                   LVESVTGGTGR"
     gtgagcgacg cgccgaagat cccgcacgaa gcgcagcaga cagcgcatcc gcatcatcca        60
     ccccgcacgg aaccggcccg ggaccgggcg acgggtgagg ggacgcccgc cggtaccggc       120
     gatgccggcc ccgcgcccat ccgctttggt accgacggct ggcgggccgt catcgccgaa       180
     gcgttcacct tcgccaacgt ccgccgggtg gcctgggccc tggccgaaca tctccaagcc       240
     accggccgcg cgagccaggg ggtggccgtc gggtacgact gccggttcct ctcggaccgg       300
     ttcgcggcca ccgtggcgtc ggtgctggcc gcggcgggga tcccggtggt cctgtcccgc       360
     accgcctgcc cgaccccggc cctcagctgg gccgtggtgt cccggaagct gggcgcgggc       420
     gtgatgatca ccgcgagcca caatcccccc gagtacaacg ggttcaaact caagggctgg       480
     ttcggcggtc ccgccctgcc cgacgagacc cgccagctcg aggcggtgct ggcccggcag       540
     gatgcgacgc ggccgcccgg gcaggagccg ccccggggca tggacctgga cgaagcccgc       600
     cgccgcggcc gcatcgagga ggccgacctc atcgctccct acaccgagca gctgcgccgg       660
     ctggtggact gggaccgcct gcgggccgcc cgcctgcggc tggtggtcga cccgatgcac       720
     ggtgctgccc ggggcgtcct ggcccagatg ctgcgggagg ccggggcgga ggtcacggag       780
     atccggggcg actggaatcc gggctttggc ggcctggccc ccgagcccat cgcccccaac       840
     ctgggcccgg ccgtggaggc ggtgaaatcc ctgggggccc aggcggtgct ggtcaccgac       900
     ggcgacggcg accgggtcgg cgcggtggac gccacggggg aggtcctgga tgcccagcgg       960
     atcttcgccc tgctgctcca gcacctggtg gaggtccgcg gctggacggg ctcggtggtc      1020
     aagaccttcg ccgggacccg catggtggac aagctggcgg cccgctacgg cctgcccttc      1080
     cgggagaccc ccatcggctt caagcacgtc tgcgagtacg ccctcaagga ggacgtgctg      1140
     atcggcggcg aggagagcgg tggcatcggc atcaagaacc acatgcccga gcgagacggc      1200
     ctgctctgca acctgctgct ggccgagatc atggccaccc gcggctgcac cctgggccag      1260
     caggtggcga cgctgatggc cgaaatcggc ccccactact tccagcgccg cgacctccac      1320
     ctgaccccgg acgggaagaa ccggctcctc cgccatcttg aggaggaccc gccggcacgg      1380
     ctggcgggct ggacggtgga gaaggtggac cccttggacg ggtgcaagct gatcttcggg      1440
     ccgagccgct ggatcctgtt ccgcgcgtcg gggaccgagc ccgtggtgcg ggtgtacgcc      1500
     gaggccgaat cgcccgcgga ggtcgaaacc ctgctggccg acggcctgcg gctggtggag      1560
     tccgtgacgg gcgggaccgg ccggtga                                          1587
//

If you have problems or comments...

PBIL Back to PBIL home page