(data stored in ACNUC30630 zone)

EMBL: CP002344.PE2

CP002344.PE2         Location/Qualifiers
FT   CDS_pept        2217..3326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="COGs: COG0592 DNA polymerase sliding clamp subunit
FT                   (PCNA homolog); InterPro IPR001001; KEGG: sth:STH2 DNA
FT                   polymerase III beta subunit; PFAM: DNA polymerase III beta
FT                   chain; PRIAM: DNA-directed DNA polymerase; SMART: DNA
FT                   polymerase III beta chain; SPTR: DNA polymerase III beta
FT                   subunit; TIGRFAM: DNA polymerase III, beta subunit; PFAM:
FT                   DNA polymerase III beta subunit, C-terminal domain; DNA
FT                   polymerase III beta subunit, N-terminal domain; DNA
FT                   polymerase III beta subunit, central domain; TIGRFAM: DNA
FT                   polymerase III, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50127"
FT                   /db_xref="GOA:E6SK03"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:E6SK03"
FT                   /protein_id="ADU50127.1"
FT                   /translation="MRLVIDQSDLHAALQVAIRGVATRSTLPVLSGILLVAEPEQLRLV
FT                   ATDMEMTVEVLAPARVQEEGSVVLPGRHLVEIVRRLPPGEVHLEVEGFRARILQERSRF
FT                   TIHGTDPGIFPAMPHISAGSTVLFDNGLLRNVLRRTTFAVSTDEGRPILTGVSFRAEGD
FT                   RLQAVATDGFRIAACSVTLERPVEGQPVAAVIPGRSLAEVARLLPDQGIGRLLLDETQA
FT                   GFQLGEVRLITRLVDGVYPDVLGLVPSEYPTRVQLPTRAFQEACERAALLADTRQPARW
FT                   VIRLAVEPGRLVITASDPELGEAREEIPAQVDGEGMVIGFNARYLVDGLKAIDTEEVLF
FT                   ELTEPLKASRLRGVGADDFTYIVLPVKIS"
     ttgcggctcg tcatcgacca gagcgacctc cacgcggcgt tgcaagtggc catccgcggc        60
     gtggccaccc gttccaccct gccggtgctg tccggcatcc tgctggtggc cgagccggag       120
     cagctgcgcc tggtggccac cgacatggag atgacggtgg aggtgctggc cccggcccgg       180
     gtccaggaag aaggatccgt ggtcctcccc gggcggcacc tggtggagat cgtgcgccgc       240
     ctgccgcccg gcgaggtgca cctggaggtg gagggcttcc gggcccggat cctgcaggaa       300
     cggtcgcgat tcaccatcca cggcaccgac ccgggcatct ttccggcgat gccgcacatc       360
     agcgccggca gcaccgtgct cttcgacaac ggcctgctgc gcaacgtgct gcgccggacg       420
     accttcgcgg tgtccaccga cgaggggcgc cccatcctga ccggcgtcag cttccgggcc       480
     gagggtgacc ggcttcaggc cgtggcgacc gacgggttcc ggatcgctgc ttgcagcgtg       540
     accctggagc ggcccgtgga agggcagccc gtggcggcgg tgatccccgg ccgcagcctg       600
     gccgaggtgg cgcgcctcct gcccgaccag gggatcgggc ggctcttgtt ggacgagacc       660
     caggccggct tccagctggg cgaggtgcgg ctgatcacgc ggctggtgga cggcgtctac       720
     cccgacgtgc tcggcctggt gccgtcggag tatcccaccc gcgtgcagct gcccacccgg       780
     gccttccaag aggcctgcga gcgggccgcc ttgctggccg atacccgcca gccggcgcgg       840
     tgggtcatcc gcctggccgt ggaacccggc cggctggtga tcacggccag cgaccccgag       900
     ctgggcgagg cgcgggagga gatccccgcc caggtggacg gcgagggcat ggtcatcggc       960
     ttcaacgccc gctacctggt ggacggcctc aaggccatcg acaccgagga ggtcctcttc      1020
     gagctgaccg agcccctgaa ggccagccgg ctccggggcg tcggcgccga cgacttcacg      1080
     tacatcgtgc tgccggtcaa gatctcgtga                                       1110
//

If you have problems or comments...

PBIL Back to PBIL home page