(data stored in ACNUC30630 zone)

EMBL: CP002344.PE200

CP002344.PE200       Location/Qualifiers
FT   CDS_pept        227023..227652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0200"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nth:Nther_2058 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50325"
FT                   /db_xref="GOA:E6SLZ5"
FT                   /db_xref="InterPro:IPR035168"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLZ5"
FT                   /protein_id="ADU50325.1"
FT                   /translation="MFLLALALGVLIGWLRGGSLSGVARLPVRWVVLLPIPFLIRSALR
FT                   HPLAANVELLSEWAFLWQGVAYGLLVVLAVVNRHLPGSTYLMAGTAANALVIMLNGGQM
FT                   PVSEWAIRVAAGGAEQVVAVTLLRTGNSLTHEVLGPETRLPWLADIIPLPRPFPFPSVA
FT                   SAGDVVIALGLLWLIITAMGARPRHAAPEGAVAHQPDEEPRVAHHE"
     atgtttctgc tggcgcttgc ccttggagtc ttgattgggt ggcttcgcgg tgggtccctg        60
     agcggggtgg cccgccttcc cgttcgatgg gtggtcctgc tcccgattcc ctttctgatt       120
     cgttcagccc ttcgtcatcc gttggctgcg aatgtcgagc tgttgagcga gtgggcgttc       180
     ctttggcagg gcgtggcgta cggcttattg gtggtccttg ccgtcgtcaa ccgccacctc       240
     cccgggtcca cgtacctcat ggcgggaacg gcggcgaacg ccctggtgat catgctgaat       300
     ggcgggcaga tgcccgtcag cgaatgggcg atccgcgtcg ccgccggtgg ggcggaacag       360
     gttgtggccg tcaccttgct acgcacgggg aacagcctca cccacgaggt gctggggccc       420
     gaaacgcgat tgccgtggct ggcggacatc atccccctgc cccgaccctt tccttttccc       480
     tcggtggcca gtgcgggtga cgtggtcatc gcgttgggct tgctgtggct gatcatcacg       540
     gcgatggggg cgcgaccccg ccatgcagca ccggaaggtg cggtggcgca ccagccggac       600
     gaagaaccgc gcgttgccca tcacgaatga                                        630
//

If you have problems or comments...

PBIL Back to PBIL home page