(data stored in ACNUC30630 zone)

EMBL: CP002344.PE210

CP002344.PE210       Location/Qualifiers
FT   CDS_pept        complement(243658..245190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0210"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="COGs: COG0628 permease; InterPro IPR002549; KEGG:
FT                   cag:Cagg_0749 protein of unknown function UPF0118; PFAM:
FT                   protein of unknown function UPF0118; SPTR: Putative
FT                   uncharacterized protein; PFAM: Domain of unknown function
FT                   DUF20"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50335"
FT                   /db_xref="GOA:E6SM05"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM05"
FT                   /protein_id="ADU50335.1"
FT                   /translation="MTTEPAVEPVRQSGEPPGEARGTGGAGSTGGTGGPPPPPAGPAWT
FT                   TLVTLLNVLAAAGVAWLAWWVLSHFARTLTLLGLAGVLAFLLEPAVSFLERGMRSRALA
FT                   ALLLYLAFVALLALGVVYLAGPIKEQAQELFWAVPQYRQQVEQAVPLLQTYMEALQAYL
FT                   SRYGVSLEPRDLASQFLERVAGNTNRILAGVTAVVTGVGTTLANALLVLVISIYLVVDG
FT                   GGLNRQMLGYLPRRYRGPVRRAQAVALRVFGGYLRGQLLLGLIIGVAVGIGMSALGMPY
FT                   PALLGVIAGVMELVPIVGAVLGAIPAILVALFQPWPAVLYVTLFFVVVQQVEGNVLVPR
FT                   ITGQAVGLHPLATLLALLAGYEIAGILGAILAVPVVAFVQALLREFNPPDPDDPADRAG
FT                   SRRRGTRARRQHRRQGGPPASTPPAPPAGTGTPGTRPGNAPPAEPEGAAGPEETGRAPG
FT                   GPSPGPGPGSSAGSGPAPRSGSEAGSGSAAGAAGSAPAAGSGPRIVITRRPA"
     ttgacgacgg aaccggcagt ggaacccgta cggcagtcgg gcgaaccgcc cggtgaggcc        60
     cggggaaccg gcggcgccgg gagcacgggc gggacgggtg ggccgccccc gccgccggcc       120
     ggcccggcct ggacgaccct ggtcaccttg ctgaacgtcc tggccgccgc aggggtcgcg       180
     tggctggcgt ggtgggtcct gtcccacttc gcccgcaccc tcaccctgct cggtctcgcg       240
     ggcgtgttgg ccttcctgct ggagcccgcc gtcagcttcc tcgagcgggg catgcgcagc       300
     cgtgccctgg ccgcgctgct gctgtatctc gccttcgtcg cgctgctggc cctcggcgtg       360
     gtctacctgg ccggccccat caaggaacag gcccaggagc tcttctgggc ggtaccgcaa       420
     taccgccagc aggtcgaaca ggcggtcccc ctgcttcaga cgtacatgga ggccctgcag       480
     gcgtacctgt ctcgttatgg cgtcagcctg gagccccggg acctggccag ccagttcctc       540
     gagcgggtgg ccggcaacac caaccggatc ctggccgggg tcaccgccgt ggtcaccggc       600
     gtcgggacca cgctggccaa cgccctgctg gtgctggtga tctcgatcta cctggtggtc       660
     gacgggggcg gcctgaaccg gcagatgctg ggctacctgc cccggcgcta ccgggggccg       720
     gtgcggcggg cccaagccgt cgccttgcgg gtgttcggcg gctacctgcg ggggcagttg       780
     ctgctcggcc tgatcatcgg cgtggcggtg ggcatcggca tgagcgccct cgggatgcct       840
     taccccgccc tgctgggggt catcgccggc gtcatggagc tcgtgcccat cgtcggggcg       900
     gtcctgggcg ccatcccggc catcctggtc gccctgttcc agccctggcc ggcggtgctc       960
     tacgtcaccc tgttcttcgt cgtcgtccag caggtcgagg gcaacgtcct ggtgccccgc      1020
     atcaccgggc aggccgtggg tctccacccg ctggcgaccc tgctggcgct gctggcaggg      1080
     tacgagatcg ccggcatcct cggcgccatc ctggccgtcc ccgtggtcgc cttcgtccag      1140
     gccctgctgc gggaattcaa cccgcccgat cccgacgacc ctgcggaccg ggccggttcc      1200
     cgccgccgtg gaacccgggc acggcggcag caccgccggc aaggtggtcc gccggcgtcc      1260
     acgcccccgg cccctccggc cggaaccgga acgccgggga cgcgccctgg gaacgcgccg      1320
     cccgcggagc cggagggcgc ggcgggtccg gaggagaccg ggcgggcacc gggcggtcct      1380
     tcgcccggac cgggaccggg ctcttcggcc gggtccggcc ccgcaccccg gtccggttcg      1440
     gaagccgggt ccggctccgc cgccggggct gccggttccg caccggccgc gggttcgggc      1500
     ccccggatcg tcatcacacg gcggccggct tga                                   1533
//

If you have problems or comments...

PBIL Back to PBIL home page