(data stored in ACNUC30630 zone)

EMBL: CP002344.PE232

CP002344.PE232       Location/Qualifiers
FT   CDS_pept        271390..272778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0232"
FT                   /product="protein of unknown function UPF0052 and CofD"
FT                   /note="COGs: COG0391 conserved hypothetical protein;
FT                   InterPro IPR002882: IPR010119; KEGG: sth:STH187
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   UPF0052 and CofD; SPTR: Putative uncharacterized protein;
FT                   PFAM: Uncharacterised protein family UPF0052; TIGRFAM:
FT                   conserved hypothetical protein, cofD-related"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50357"
FT                   /db_xref="GOA:E6SM27"
FT                   /db_xref="InterPro:IPR002882"
FT                   /db_xref="InterPro:IPR010119"
FT                   /db_xref="InterPro:IPR038136"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM27"
FT                   /protein_id="ADU50357.1"
FT                   /translation="MKLADWLLPGLRIKRWLVVFAAGLYLVALGGAMAAGADLWAAAAG
FT                   WLRRPWLAVTGRFVPEPWPGVAVMALGGFLALGATYRLLRVVAELLTPAGGSNGGAVDR
FT                   LVLRRRLDRGPRVVAIGGGTGLSVLLRGLKEYTGNVTAVVTVTDDGGSSGRLRGELGIL
FT                   PPGDIRNCLVALADAEPLMARLFQHRFTQGTLAGHSLGNLVIGALAELLGDFEQAVYES
FT                   SKVLAVRGRVLPSTLTPVTLVARMADGRVVRGETAIASDAAPIERIWLDPPGVEPPPAA
FT                   IEAIEAADLIVLGPGSLYTSILPNLLIPGICDAVRRSRAVKVLVVNAMTQPGETTGYTA
FT                   ADHARALIDAVGPGVFHHVLVNVQQPPAALLQRYRQQGQEPVRLDRERLRQMGLQVHTA
FT                   RLLAGDDFVRHDPQRLARALLRVLLAARPRVNPRRRLDFFLLGERLWREEAGSAEPARA
FT                   ARDA"
     atgaagctgg ctgactggct cttgcccggc ctgcgcatca agcgatggct ggtggtcttc        60
     gccgcggggc tgtatctggt ggccctgggc ggggccatgg ccgccggcgc cgacctctgg       120
     gcggcggcgg cgggctggct gcgccgcccg tggctggcgg tgacgggccg gttcgtcccc       180
     gagccctggc cgggggtggc ggtgatggcc ttggggggct ttctggccct gggcgccacc       240
     taccggctcc tgcgggtggt ggccgagctc ctcaccccgg cgggcggttc caacggcggc       300
     gcggtggacc gcctcgtcct gcggcggcgg ctggaccgcg ggccgcgggt ggtggccatc       360
     ggcggcggca ccggcctctc cgtgctgctg cgcgggctca aggagtacac gggcaacgtc       420
     acggcggtgg tcaccgtcac cgatgacggt ggcagttccg gccgcctccg cggcgagctg       480
     ggcatcctgc cccccggcga catccgcaac tgcctggtcg ccctggccga cgccgagccc       540
     ctgatggccc ggctcttcca gcaccgcttc acccagggga ccctggccgg ccacagcctg       600
     ggcaacctgg tcatcggcgc cctggcggag ttgctgggcg acttcgagca ggcggtgtac       660
     gaatccagca aggtgctggc cgtgcggggg cgggtgctgc cttcgaccct cacgcccgtc       720
     accctggtgg cgcgcatggc cgacgggcgc gtggtccgcg gggagacggc catcgccagc       780
     gacgcggcgc ccatcgagcg aatctggctg gacccgccgg gggtggagcc gccgccggcc       840
     gccatcgagg ccatcgaggc ggcggacctg atcgtcctgg ggccgggcag cctgtacacc       900
     agcatcctgc ccaacctgct gatccccggc atctgcgacg ccgtgcgccg ctcccgggcc       960
     gtcaaggtcc tggtggtcaa cgccatgacc cagcccggcg agaccacggg ctataccgcc      1020
     gccgaccacg ctcgggccct gatcgacgcc gtgggacccg gcgtgttcca ccacgtgctg      1080
     gtcaacgtcc agcaaccgcc ggcggccctg ctgcagcggt accggcagca gggccaggag      1140
     ccggtgcgcc tggaccgcga gcggctgcgg cagatgggct tgcaggtgca cacggcgcgg      1200
     ctgctggcgg gggacgactt cgtccgccac gacccccagc ggctggcccg ggccctgttg      1260
     cgggtgctgc tggcggcccg gccgcgggtc aacccgcgcc ggcggctgga cttcttcctg      1320
     ctgggcgagc gcctgtggcg ggaggaggcg gggtcggcgg aaccggcccg ggcggcacgg      1380
     gacgcgtaa                                                              1389
//

If you have problems or comments...

PBIL Back to PBIL home page