(data stored in ACNUC30630 zone)

EMBL: CP002344.PE260

CP002344.PE260       Location/Qualifiers
FT   CDS_pept        301188..303362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0260"
FT                   /product="carbohydrate kinase, YjeF related protein"
FT                   /note="COGs: COG0063 sugar kinase; InterPro IPR004443:
FT                   IPR000631; KEGG: pap:PSPA7_5678 hypothetical protein; PFAM:
FT                   YjeF-family domain-containing protein; protein of unknown
FT                   function UPF0031; SPTR: Putative uncharacterized protein;
FT                   TIGRFAM: carbohydrate kinase, YjeF related protein; PFAM:
FT                   Carbohydrate kinase; YjeF-related protein N-terminus;
FT                   TIGRFAM: yjeF N-terminal region; yjeF C-terminal region,
FT                   hydroxyethylthiazole kinase-related"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50385"
FT                   /db_xref="GOA:E6SM55"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM55"
FT                   /protein_id="ADU50385.1"
FT                   /translation="MTAEEPAGTAGRTIEGTATGVSATPGGASVTEGGAYATPGEPPTT
FT                   PAGAPATGLAPASGTGPGADPGPAGTWVLSAAAVRRGDRLAADAGLGGPVLMETAGRTA
FT                   ATLLWKVAGPFSAREPVVVLAGGGNNGGDGMVLARWVARWAGPAAVKVFLLAEPGRLRG
FT                   EAAVQWSLLARAGVPAIALAGEPAPGAQQGTRQNPGAGAAPVAAEFPEPGAGRQPTAGP
FT                   AGAAGPHPGAGLQPGAGRPAAAGPGSGVGLAVDPFLDHLEAAVARARVVVDALLGVGVR
FT                   GALRPLAARALEVVGAAGVPVFALDLPSGLDADTGEAAPVVPRATWTATFAAAKWGLLL
FT                   GQGPERAGQVFVVDIGWPQAAGAGGTGGEAEAGAPGGTGGFPAARVLDAAGVAALLPRR
FT                   PWDAHKGWAGHVVVAGGRPGQVGAAVLAGTAALQAGAGTVTLAVPAPVRTEAAVHRPEI
FT                   MTWALPATAGGEWDAAAATALAEREGERRGRVVRVIGPGLGQSPGAAACLAQWLGLGDP
FT                   SAAGGPADPGPAGGPPAGAPAFPPTVLDADGLNLAARLGIDRLRERPGPFPLVLTPHPG
FT                   EAARLLGWTTAQVQARRPLAALELARRSGAVAVLKGAGTLIASPAGDLYVCTRGHPGMA
FT                   SAGMGDALAGVAGAMLAQGLEPLAAALAAVFLHALAGELAAPAAGIPVRATELIARLPA
FT                   ALELVRRGLPRGTEALGVPGVAWLRPPLAG"
     gtgacggcgg aagaaccggc cggcaccgca gggagaacca ttgagggcac tgcaaccggg        60
     gtgtccgcga cgccgggtgg ggcatccgtg accgagggag gggcatacgc gacgcctgga       120
     gagccgccca cgaccccggc cggggcgccc gccaccggcc tcgcgccggc cagcggcacc       180
     ggcccgggag cggatccggg gcccgccggg acgtgggtgc tctcggctgc ggcggtccgg       240
     cgcggcgacc gcctggccgc ggacgccggg ctgggcggcc cggtgctcat ggagacggcc       300
     gggcgtacgg cggccaccct gctctggaag gtggcaggcc ccttctcggc gcgggagccc       360
     gtggtggtcc tggccggcgg cgggaacaac ggcggcgacg ggatggtgct ggcccgctgg       420
     gtggcccgct gggcggggcc cgccgcggtg aaggtcttcc tgctggcgga acccgggcgg       480
     ttgcggggcg aggcggcggt gcaatggtcc ctgctggccc gtgcgggcgt gccggcgatc       540
     gcgctggcgg gtgaaccggc cccgggcgcc cagcagggaa cccgccagaa ccccggggcg       600
     ggggcggcac cggtggcggc cgagttcccg gagcccgggg cgggccggca acccacggcg       660
     ggtccggctg gcgcggcggg cccgcacccc ggggccgggt tgcaacccgg agcgggccgg       720
     ccggccgcgg ccggcccggg atccggggtg gggctggcgg tggacccgtt tctcgaccac       780
     ttggaagccg ccgtcgcccg cgcccgggtg gtggtcgatg ccctgctggg cgtgggggtg       840
     cggggcgccc tgcgtcccct ggccgcccgg gccctggagg tggtgggggc cgcgggggtg       900
     ccggtcttcg ccctggattt gccctcgggc cttgacgccg acaccgggga ggcggcgccg       960
     gtggtgcctc gcgccacgtg gaccgccacc ttcgccgcgg ccaagtgggg tctcttgctc      1020
     ggccaggggc cggaacgggc cgggcaggtc ttcgtggtcg acatcggctg gccgcaggcg      1080
     gccggcgccg gcgggacggg cggtgaggcg gaagccggcg cgcccggcgg caccgggggg      1140
     ttccccgccg cccgcgtcct cgacgcggcc ggcgtggcgg ctctcctgcc ccggcggccc      1200
     tgggatgccc acaagggctg ggcgggtcac gtcgtcgtgg ccggcggccg cccgggccag      1260
     gtcggggcgg cggtcctggc gggcacggcc gccctgcagg ccggggcggg caccgtgacc      1320
     ctggccgtgc ccgccccggt gcggaccgag gccgcggtcc accgcccgga gatcatgacc      1380
     tgggccctgc ccgccacagc cggcggcgag tgggacgcgg cggccgccac cgcgctggcg      1440
     gaacgggaag gggagcgccg gggccgggtg gtacgggtca tcgggccggg gctgggccaa      1500
     agcccggggg cggcggcctg cctggcccaa tggctcgggc tgggcgatcc gtccgctgcc      1560
     ggcgggcccg cggatcctgg tcccgcgggc ggtccgcccg ccggcgcgcc ggccttcccg      1620
     cccaccgttc tggacgccga cggcctcaac ctggcggccc gcctgggtat cgaccggctg      1680
     cgggagcggc cgggaccctt cccgctggtg ctgacgcccc accccgggga ggcggcccga      1740
     ctgctgggct ggaccacggc ccaggtgcag gcccggcggc ccctggcggc cctcgagctg      1800
     gcccgccggt cgggggcggt ggccgtcctc aagggggccg gcaccctgat tgccagcccc      1860
     gcgggcgacc tgtacgtctg cacccggggg catcccggca tggccagcgc cggcatgggc      1920
     gacgccctgg ccggcgtcgc gggggccatg ctggcccagg ggctcgaacc cctggccgcc      1980
     gccctggcgg ccgtgttcct ccacgccctg gcaggggaac tggcggcgcc cgcggccggc      2040
     atcccggtcc gggccacgga gctcatcgcc cggctccccg ccgccttgga actggtccgg      2100
     cgcgggctgc cccgcggcac cgaagccctg ggcgtgccgg gcgtggcgtg gttgcggccg      2160
     ccgctggccg gctga                                                       2175
//

If you have problems or comments...

PBIL Back to PBIL home page