(data stored in ACNUC30630 zone)

EMBL: CP002344.PE261

CP002344.PE261       Location/Qualifiers
FT   CDS_pept        303616..304800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0261"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /note="COGs: COG0787 Alanine racemase; InterPro IPR001608:
FT                   IPR011079: IPR000821: IPR020622; KEGG: chl:Chy400_1942
FT                   alanine racemase; PFAM: alanine racemase domain protein;
FT                   PRIAM: Alanine racemase; SPTR: Alanine racemase; TIGRFAM:
FT                   alanine racemase; PFAM: Alanine racemase, C-terminal
FT                   domain; Alanine racemase, N-terminal domain; TIGRFAM:
FT                   alanine racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50386"
FT                   /db_xref="GOA:E6SM56"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM56"
FT                   /protein_id="ADU50386.1"
FT                   /translation="MEGPGRGRPVRPTWVEVDLDAIAHNVQTLQRLAAPAQLMAVVKAD
FT                   GYGHGAVMVARTALAHGARRLAVAVVEEGVHLRQSAIACPILVMGWTPPWQYSLALRYD
FT                   LELAVSSEDEARALAEAARREGRKVRVHLKVDTGMGRLGLRWDHPRLAETAARIAGLGG
FT                   LEVVGVFTHLATADDPEAPLTEDQLARFARIVHALDERGLRPLLRHAANSAALLRLPGA
FT                   RYDLVRPGIALYGLEPFPGAVAAFGLRPALAWKTRVALVKEVPPGTPISYGATFVTRRR
FT                   SRIATLPVGYADGLRRALSNRGQVLVGGRRAPIVGRVCMDQVMVDVTDAGPVAVGDEVV
FT                   LIGRQGDQQITADEMAGWMDTIGYEVVTGIGRRVPRIYLRGGRPVAQAPVSHLL"
     ttggaagggc cgggccgggg gcggccggtg cgccccacct gggtggaagt cgacctggac        60
     gccatcgccc acaacgtgca aaccctccag cggctggccg cccccgccca gctcatggcg       120
     gtggtcaagg ccgacggcta cggccacggc gcggtgatgg tcgcccgcac ggccctggcc       180
     catggtgccc gccgcctggc cgtggcggtg gtggaagagg gcgtccacct gcgccagtcg       240
     gccatcgcct gtcccatcct ggtcatgggc tggaccccgc cctggcagta cagcctggcg       300
     ctgcgctacg acctggagct ggcggtcagc agcgaggacg aggcccgggc cctggccgag       360
     gccgcccgcc gcgagggccg caaggtgcgg gtgcacctga aggttgacac cggcatgggc       420
     cgcctgggcc tgcgctggga ccatccgcgg ttggccgaga cggcggcccg gatcgccggc       480
     ctggggggcc tggaggtggt cggggttttc acccacctgg ccacggccga cgaccctgaa       540
     gcccccctca ccgaggacca gctggcccgc ttcgcccgga tcgtccacgc cctggacgag       600
     cgcggcctgc ggcccctcct gcggcacgcg gccaacagcg ccgccctgct gcggctgccc       660
     ggggcccggt acgacctggt ccgccccggc atcgccctct acgggctcga gcccttcccc       720
     ggcgccgtgg cggccttcgg cctgcggccc gccctggcgt ggaagacacg ggtcgccctc       780
     gtcaaggagg tccctcccgg cacccccatc agttacgggg ccaccttcgt cacccgccgc       840
     cgctcccgca tcgccacctt gccggtgggg tacgccgacg gattgcggcg ggccctgtcc       900
     aaccgcggac aggtgctggt gggcggccgg cgcgcgccca tcgtgggccg ggtctgcatg       960
     gaccaggtga tggtcgacgt gaccgacgcc gggccggtgg ccgtggggga cgaggtcgtc      1020
     ctcatcggcc gccagggcga ccagcagatc accgccgacg agatggcggg ctggatggac      1080
     accatcggct acgaggtggt caccggcatc gggcgccggg tgccccgcat ctacttacgg      1140
     gggggccgtc ccgtggcgca ggcgccggtg tcccacctgc tgtga                      1185
//

If you have problems or comments...

PBIL Back to PBIL home page