(data stored in ACNUC30630 zone)

EMBL: CP002344.PE266

CP002344.PE266       Location/Qualifiers
FT   CDS_pept        307654..308247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0266"
FT                   /product="Uncharacterized protein family UPF0079, ATPase"
FT                   /note="COGs: COG0802 ATPase or kinase; InterPro IPR003442;
FT                   KEGG: hmo:HM1_1717 hypothetical protein; PFAM:
FT                   Uncharacterised protein family UPF0079, ATPase; SPTR:
FT                   Putative uncharacterized protein; PFAM: Uncharacterised
FT                   P-loop hydrolase UPF0079; TIGRFAM: ATPase, YjeE family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50391"
FT                   /db_xref="GOA:E6SM61"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM61"
FT                   /protein_id="ADU50391.1"
FT                   /translation="MVTVAWTARIPSAEAMERLGERLAAALQPGDWIALTGPLGAGKTT
FT                   LVRGLARGLGFRGRVASPTFTLVHVYRGRLPLYHLDLYRLEGEDALRDVVDPGEMEAAG
FT                   AVVVEWADRAPRWIPADALWLDLAVDPAGDGRRVAARAGGDRARRLAAHLAHRADPAVE
FT                   PAAGAIPAGPGAAGPGSPGGEAGRPATGKDEGRR"
     atggtgacgg tcgcctggac ggcccggatc ccgtcggctg aagccatgga gcgactcggg        60
     gaacggctgg ccgcggccct gcagccgggg gactggatcg ccctgaccgg gcccctgggc       120
     gcgggcaaga ccaccctggt gcgggggctg gcgcggggcc tggggttccg ggggcgggtc       180
     gccagtccca ccttcaccct ggtccacgtg taccggggcc ggctgcccct ctaccacctg       240
     gacctgtacc ggctggaagg cgaagacgcc ctgcgggacg tggtcgaccc cggcgagatg       300
     gaggcggcgg gggcggtggt ggtggagtgg gccgaccggg cgccgcggtg gatccctgcc       360
     gacgccctgt ggctggacct ggctgtggac ccggcagggg acggccgccg cgtggcggcc       420
     cgggcgggag gggaccgcgc ccggcggctg gcggcccacc tcgcccaccg ggcggatccg       480
     gcggtggagc ctgcggcggg ggcgatccct gcgggtcctg gtgcggcggg cccgggcagc       540
     cccggcgggg aagccggccg gccggcgacg ggaaaggacg agggtaggcg gtga             594
//

If you have problems or comments...

PBIL Back to PBIL home page