(data stored in ACNUC30630 zone)

EMBL: CP002344.PE276

CP002344.PE276       Location/Qualifiers
FT   CDS_pept        320209..320823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0276"
FT                   /product="GTP cyclohydrolase subunit MoaC"
FT                   /note="COGs: COG0315 Molybdenum cofactor biosynthesis
FT                   enzyme; InterPro IPR002820; KEGG: mta:Moth_2134 GTP
FT                   cyclohydrolase subunit MoaC; PFAM: molybdopterin cofactor
FT                   biosynthesis protein MoaC; SPTR: GTP cyclohydrolase subunit
FT                   MoaC; TIGRFAM: molybdenum cofactor biosynthesis protein C;
FT                   PFAM: MoaC family; TIGRFAM: molybdenum cofactor
FT                   biosynthesis protein MoaC"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50401"
FT                   /db_xref="GOA:E6SME1"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/TrEMBL:E6SME1"
FT                   /protein_id="ADU50401.1"
FT                   /translation="MNGSSHPPDEPAWTHLDPAGQARMVDTSGKAATVREAVARGRVRM
FT                   APATLARLRAGAVPKGDVWAVARVAGIMAAKETGRLIPLCHPLPLDAVTVDFRLGPEAV
FT                   EIQATARTVARTGVEMEAMVAVAVAALTLVDMCKALDKGMVVEGIRLVRKTGGRSGEYA
FT                   RPGEPPWEALGDPVGPGGRGRAGDGEGTQAVQAAQQGPGPG"
     gtgaacggtt cctcccaccc gccggacgaa ccggcctgga cccacctgga ccccgcgggc        60
     caggcgcgca tggtggatac cagcggcaag gcggccaccg tccgggaggc cgtggcccgg       120
     ggccgggtgc gcatggcccc tgccaccctg gcccggctgc gggcgggggc cgtgcccaag       180
     ggggatgtat gggctgtggc ccgggtggcg ggcatcatgg cggccaagga gacgggccgg       240
     ctcatccccc tgtgccatcc cctgcccctg gatgcggtga ccgtcgactt ccggctgggg       300
     ccggaggcgg tggagatcca ggccacggcc cgcaccgtgg cccgcacggg ggtcgagatg       360
     gaggccatgg tggcggtggc cgtggccgcc ctgaccctgg tggacatgtg caaggccctg       420
     gacaagggga tggtcgtcga aggcatccgg ctggtgcgga agaccggcgg gcgcagcggc       480
     gagtatgccc ggcccggcga gcccccgtgg gaggcgctgg gcgacccggt ggggcccggg       540
     gggcgcggcc gggccggcga tggagagggc acccaggccg tccaggccgc ccaacagggg       600
     ccgggcccgg ggtaa                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page