(data stored in ACNUC30630 zone)

EMBL: CP002344.PE282

CP002344.PE282       Location/Qualifiers
FT   CDS_pept        324752..326332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0282"
FT                   /product="GMP synthase (glutamine-hydrolyzing)"
FT                   /EC_number="6.3.5.2"
FT                   /note="COGs: COG0519 GMP synthase PP-ATPase domain/subunit;
FT                   InterPro IPR000991: IPR001674: IPR004739: IPR017926: IPR
FT                   011702: IPR006220: IPR001317; KEGG: mta:Moth_2105 GMP
FT                   synthase; PFAM: GMP synthase domain protein; glutamine
FT                   amidotransferase class-I; SPTR: GMP synthase
FT                   [glutamine-hydrolyzing]; TIGRFAM: GMP synthase, large
FT                   subunit; GMP synthase, small subunit; PFAM: GMP synthase C
FT                   terminal domain; Glutamine amidotransferase class-I;
FT                   Asparagine synthase; TIGRFAM: GMP synthase
FT                   (glutamine-hydrolyzing), C-terminal domain or B subunit;
FT                   GMP synthase (glutamine-hydrolyzing), N-terminal domain or
FT                   A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50407"
FT                   /db_xref="GOA:E6SME7"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E6SME7"
FT                   /protein_id="ADU50407.1"
FT                   /translation="MRMSMTDLEPSRVEPEERVVILDFGSQYGHLIARRVRELGVYSVV
FT                   LPHHAPLAEILRHRPRGVILSGGPASVYEPGAPQCDPGLWQAGVPVLGICYGMQLMVHQ
FT                   LGGRVDRADHREYGPATLEVEEPGRLLAGLGPRVDVWMSHGDRVDALPPGFTVLARTAG
FT                   SPYAAVEGGDGRWLGVQFHPEVAHTPRGREILANFLYRVCGCKGGWSMAEFVERAVPAL
FT                   RRQLAGARALCALSGGVDSAVAAALVHRAIGPRLICVFVDTGLLREGEVEEVRSIFTGL
FT                   GMDLRVVDARDRFLAALDGLADPEAKRKAVGETFIRVFEEEARRLEAQVGAIPFLVQGT
FT                   TYPDVIESGGGAAATIKSHHNVGGLPADLEFQLVEPLRDLFKDEVREVGRRLGLPPAIV
FT                   DRQPFPGPGLAIRMIGPVTAERLQRLRACDRIVREEIRRAGLEDRLWQAFAVLTGTPTV
FT                   GVMGDRRTYGEAVAVRAVTSDDGMTADWARLPYEVLDRIARRLANEVEGVNRVVYDVTS
FT                   KPPATIEWE"
     atgcgcatga gcatgacgga cctggaaccg tcccgggtgg aacccgaaga gcgcgtggtg        60
     atcctggact tcggctcgca gtacggtcac ctcatcgccc ggcgggtgcg ggaactgggg       120
     gtgtactcgg tggtcctgcc tcaccacgcg cccctggccg agatcctccg gcaccggccg       180
     cgcggggtga tcctgtccgg cgggccggcc agtgtctacg agccgggcgc gccccagtgc       240
     gacccgggct tgtggcaggc cggcgtcccg gtgttgggca tctgctacgg catgcagctc       300
     atggtccacc agctgggcgg ccgggtcgac cgggcggacc accgggagta cggccccgcc       360
     accctggagg tggaggaacc cggccggttg ctggcgggcc tcggcccccg ggtggacgtc       420
     tggatgagcc acggcgaccg ggtcgacgcg ctaccgccgg gcttcaccgt cctggcccgc       480
     acagccggct cgccctacgc ggcggtggag ggcggtgacg ggcgctggct tggcgtccag       540
     ttccaccctg aggttgccca cacgccccgg ggccgggaga tcctggccaa cttcctgtac       600
     cgcgtctgcg gctgtaaggg cggatggtcc atggccgagt tcgtcgaacg ggcggtgccg       660
     gccctgcgcc ggcagctggc aggcgcccgg gccctctgcg ccttgagcgg cggcgtcgat       720
     tccgcggtgg cggcggccct ggtccaccgg gccatcgggc cgcgcctgat ctgcgtgttc       780
     gtcgacaccg ggctcttgcg ggaaggagag gtggaggagg tccggtcgat cttcaccggg       840
     ctcggcatgg acctgcgggt ggtcgacgcc cgggaccgct tcctggcggc gctggacggc       900
     ctggccgacc ccgaagccaa gcgcaaggcc gtgggcgaga ccttcatccg cgtgttcgaa       960
     gaagaggccc ggcggctgga ggcccaggtg ggcgccatcc ccttcctggt ccagggcacc      1020
     acctatcccg acgtcatcga aagcggcggc ggtgcggcgg cgaccatcaa gagccaccac      1080
     aacgtgggcg gcctgccggc cgatctggag ttccagctgg tggagccgct gcgtgacctg      1140
     ttcaaggacg aggtccggga ggtgggccgg cgcctggggt tgccgccggc catcgtcgac      1200
     cggcagccct tcccggggcc ggggctggcg atccgcatga tcggccccgt caccgccgaa      1260
     cggctccagc ggttgcgggc ctgcgaccgc atcgtccggg aggagatccg ccgggcgggg      1320
     ctggaggacc ggctgtggca ggccttcgcc gtcctgacgg gcacgcccac ggtgggcgtg      1380
     atgggcgacc gccgcaccta cggcgaggcg gtggcggtgc gcgcggtgac gtccgacgac      1440
     ggcatgaccg ccgactgggc ccgcctgccc tatgaggtcc tggaccgcat cgcccggcgc      1500
     ctggccaacg aagtggaggg cgtcaatcgc gtggtctacg acgtgacctc caagccgcct      1560
     gcgaccatcg agtgggagtg a                                                1581
//

If you have problems or comments...

PBIL Back to PBIL home page