(data stored in ACNUC30630 zone)

EMBL: CP002344.PE283

CP002344.PE283       Location/Qualifiers
FT   CDS_pept        326605..326715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0283"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50408"
FT                   /db_xref="UniProtKB/TrEMBL:E6SME8"
FT                   /protein_id="ADU50408.1"
FT                   /translation="MRVGGGAMFYRLLAAAAGIVTGLVAALNSQVSWPIG"
     ttgagggtgg gaggtggcgc catgttctat cgcctgctgg cggccgcagc cggcatcgtg        60
     accggcctgg ttgcggcctt gaacagccag gtgagctggc ccatcggcta a                111
//

If you have problems or comments...

PBIL Back to PBIL home page