(data stored in ACNUC30630 zone)

EMBL: CP002344.PE288

CP002344.PE288       Location/Qualifiers
FT   CDS_pept        336986..337915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0288"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG0601 ABC-type dipeptide/oligopeptide/nickel
FT                   transport systems permease components; InterPro IPR000515;
FT                   KEGG: bbe:BBR47_17640 oligopeptide ABC transporter permease
FT                   protein; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; SPTR: Oligopeptide ABC
FT                   transporter permease protein; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50413"
FT                   /db_xref="GOA:E6SMF3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMF3"
FT                   /protein_id="ADU50413.1"
FT                   /translation="MRRYVIQRLALMLVSIWAVVTLTFVMMHAIPGNPFADPRLRPEIL
FT                   ALMMDKYGLNDPLWEQYLRYWGNLLQGDLGVSLKNIGQSVNRMIAEGFPWSAWIGGQAL
FT                   IFALAVGLTLGTIAALNRNRWPDYAAMVIAVLGVSVPSFVIAVFAQWLFAVKLNWVPVL
FT                   WNGTWQTSILPSLALGGTMLATLVRMMRTQMLDVMGQDYINTARAKGLSQGEVIWRHAL
FT                   RNAILPIVTILGPLVAGILTGTVVIEAIFGIPGLGKYYVESVYQRDYPLILGTTVFYFI
FT                   FLIVANFLVDLSYGIIDPRIRLTNRARG"
     gtgcgccgtt acgtgatcca acggttggcg ctgatgctgg tgtccatctg ggccgtggtg        60
     accctcacct tcgtgatgat gcacgccatt ccaggcaacc cctttgcaga cccgcggcta       120
     cgccccgaga tcctggccct gatgatggac aagtacggcc tcaacgaccc gctctgggag       180
     cagtacctgc gctactgggg taacctgctc cagggtgacc tgggcgtgtc cttgaagaac       240
     atcggccaga gcgtcaaccg catgatcgcc gaaggcttcc cgtggtcggc gtggatcggt       300
     ggccaggcgc tcatcttcgc cctggcggtg ggtctcacgc tcggcaccat tgcggccctc       360
     aaccggaacc gttggcccga ctacgcggct atggtcatcg cggtgctggg cgtgtcggtg       420
     cccagcttcg tcattgccgt attcgcccag tggctctttg ccgtgaagct caactgggtc       480
     ccggtgctgt ggaacgggac gtggcagacc tccatcctgc cgtccctggc cctgggtggc       540
     accatgctgg ccacgctggt gcgcatgatg cggacccaga tgctggatgt gatgggtcag       600
     gattatatca acaccgcgcg ggccaaaggc ctctcccagg gtgaggtcat ctggcggcac       660
     gccctgcgca atgccatcct gcccatcgtg accattctcg gcccgctggt ggccggcatc       720
     ctgacgggca ccgtggtcat cgaggccatc tttggcattc ccggccttgg caagtattac       780
     gttgagagcg tttatcaaag ggactatccc ttgatcttgg gtaccacggt gttctacttc       840
     atcttcctga tcgtcgccaa cttcctggtc gacctgtcct acgggatcat cgacccgcgc       900
     atccggctga cgaaccgggc cagggggtga                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page