(data stored in ACNUC30630 zone)

EMBL: CP002344.PE290

CP002344.PE290       Location/Qualifiers
FT   CDS_pept        338906..339916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0290"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="COGs: COG0444 ABC-type dipeptide/oligopeptide/nickel
FT                   transport system ATPase component; InterPro IPR003593:
FT                   IPR003439: IPR013563: IPR010066: IPR 017871; KEGG:
FT                   tpd:Teth39_1686 oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase; SPTR: Oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter; Oligopeptide/dipeptide transporter,
FT                   C-terminal region; TIGRFAM: oligopeptide/dipeptide ABC
FT                   transporter, ATP-binding protein, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50415"
FT                   /db_xref="GOA:E6SMF5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMF5"
FT                   /protein_id="ADU50415.1"
FT                   /translation="MEKLLEVRDLRVHFRTHGGEVQAVRGVSFDLHKGETLCIVGESGC
FT                   GKSVTAQTIMRLIPMPPGRIVSGSIRFQGQDLVRLPEREMQKIRGRSMGMIFQDPMTSL
FT                   NPTMTIGRQIAEPLIKHQGMRPDQARARAVELLQMVGIPNPEERVRQYPHQFSGGMRQR
FT                   AMIAIALACNPALLIADEPTTALDVTIQAQILELMQDLKQRLGTAIILITHDLGVVARM
FT                   ADRIAVMYAGQIVEQGTAEEIFHHPKHPYTEALLRSIPRLDDRRERLQAIPGTPPDLFA
FT                   PPAGCPFAARCPYTMRVCHDYDPELEEIRPGHYAKCWLHHPYAPVVGLNAEERGA"
     atggagaagc tgttggaagt tcgcgatctg cgcgtccatt tccgtaccca cggcggcgag        60
     gtccaggcgg tccgcggcgt ctcattcgat ctgcacaagg gcgagacgct atgcatcgtg       120
     ggcgagtcgg gctgcggcaa gtccgtcacc gcccagacca tcatgcgcct gattcccatg       180
     ccgccggggc ggatcgtcag cgggtccatc cggttccagg gccaggacct ggtcaggctg       240
     cccgagcggg agatgcaaaa gatccggggg cggtccatgg gcatgatctt ccaggacccg       300
     atgacctccc tcaacccgac catgaccatc gggcggcaga tcgcggagcc gctgatcaag       360
     catcagggga tgcggcccga ccaggcccgg gcgcgggcgg tggagttgct gcagatggtg       420
     gggatcccca accccgagga gcgggtgcgc cagtaccccc accagttctc gggcggcatg       480
     cgccagcggg ccatgatcgc cattgccctg gcctgcaacc cggcgctgct gatcgccgac       540
     gagcccacca cggccctgga cgtgaccatc caggcgcaga tcctggaact gatgcaggat       600
     ctcaagcagc gcctgggcac ggccatcatc ctgatcaccc acgacctggg cgtggtggcg       660
     cgcatggcgg accggatcgc cgtgatgtac gcgggccaga tcgtggagca ggggacggcc       720
     gaggagatct tccaccatcc caagcacccg tacaccgaag cgctgctgcg gtccatcccg       780
     cgcctcgacg accggcgcga gcggctacag gccatcccgg gcacgccacc cgacctgttc       840
     gcaccgccgg cgggttgccc ctttgctgcc cggtgcccgt acacgatgcg ggtgtgccac       900
     gactacgacc ccgagctgga ggagatccgg cccgggcact acgccaagtg ctggctgcat       960
     catccctacg cgccggtggt gggcctgaac gcggaggaaa ggggggcgtg a               1011
//

If you have problems or comments...

PBIL Back to PBIL home page