(data stored in ACNUC30630 zone)

EMBL: CP002344.PE298

CP002344.PE298       Location/Qualifiers
FT   CDS_pept        348929..350110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0298"
FT                   /product="peptidase M24"
FT                   /note="COGs: COG0006 Xaa-Pro aminopeptidase; InterPro
FT                   IPR000587: IPR000994; KEGG: sti:Sthe_0528 peptidase M24;
FT                   PFAM: peptidase M24; creatinase; SPTR: Peptidase M24; PFAM:
FT                   Metallopeptidase family M24; Creatinase/Prolidase
FT                   N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50423"
FT                   /db_xref="GOA:E6SMG3"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMG3"
FT                   /protein_id="ADU50423.1"
FT                   /translation="MWWISDGELARRRRRVLAELSERGAAAFLTYNPTSIFYLTNFHFI
FT                   PTERPAALLLEESGRCGLLVPRLELEHAQLVARVDEVRDYPEYPGEVHPMEHLARWLKD
FT                   RGLGAAHLLAEAAGYASSWGYQGPPLTELLPGARITVDAKLIERHRLVKSPEEIALIRE
FT                   SCRWGNLAHELLQEYAVPGASEVEISHRASHEATMAMIRAFGRGRRPVGPLSAFAGFRG
FT                   QVGPNSALPHAVTINAVLKRGDVLVTGATASVGGYLSELERTMFVGEPSPEQVRFFQHM
FT                   LELQEVAFAAIKPGVPCSAVDREVRRYYDEHNLWPYWRHHVGHNIGLLGHEAPFLDIGD
FT                   ETLIEPGMLFTVEPGLYVPGLGGFRHSDTVLVTEDGIEILTYYPRDLESLICG"
     atgtggtgga ttagcgacgg cgaactggcc cgccgccggc ggagggtgct ggccgagctg        60
     agcgagcggg gcgcggccgc gttcctcacg tacaacccga cgtccatctt ttacttgacg       120
     aacttccact tcatccccac cgagcggccg gcggcgctgt tgctggagga atcgggtcgc       180
     tgcgggctgc tggtgccccg gctggagctg gaacacgccc agctggtggc cagggtcgac       240
     gaggtgcggg actatccgga gtacccgggc gaggtccacc ccatggagca cctggcccga       300
     tggctcaagg accgggggct cggggccgcc cacctgctgg ccgaggcggc gggctacgcc       360
     tcctcctggg ggtaccaggg accgcccctc accgagctcc tgcccggtgc ccgcatcacc       420
     gtggatgcca agctgatcga acggcaccgg ctggtgaagt cgcccgagga gatcgccctg       480
     atccgggaga gctgccggtg ggggaacctg gcccacgagc ttctgcagga gtatgcggtt       540
     cccggcgcca gcgaggtgga gatcagccac cgggcttccc acgaggcgac catggccatg       600
     atccgcgcct tcggccgggg acggcggccc gtggggccgc tgtcggcctt cgccggcttc       660
     cgcggccagg tcggtcccaa cagcgccctg ccccacgccg tgaccatcaa tgcggtgctg       720
     aagcggggcg acgtgctggt caccggcgcc acggcctccg tgggcgggta cctgagcgag       780
     ctggagcgga ccatgttcgt gggcgagccg agccccgagc aggtccggtt cttccagcac       840
     atgcttgagc ttcaggaggt ggccttcgcg gccatcaagc cgggggtgcc ctgctccgcc       900
     gtcgaccgcg aggtgcgccg ctactacgac gagcacaacc tctggcccta ctggcgccac       960
     cacgtgggcc acaacatcgg cctgctgggc cacgaggcgc ccttcctgga catcggcgac      1020
     gagaccctga tcgaacccgg catgctgttc acggtcgaac ccggcctcta tgtgccgggc      1080
     ctgggtgggt tccgccactc ggacacggtg ctggtaaccg aagacggcat cgagatcctg      1140
     acctactacc cgcgggacct ggagagcctg atctgcgggt ag                         1182
//

If you have problems or comments...

PBIL Back to PBIL home page