(data stored in ACNUC30630 zone)

EMBL: CP002344.PE306

CP002344.PE306       Location/Qualifiers
FT   CDS_pept        359868..361685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0306"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="COGs: COG0747 ABC-type dipeptide transport system
FT                   periplasmic component; InterPro IPR000914; KEGG:
FT                   pca:Pcar_1870 dipeptide transport protein; PFAM:
FT                   extracellular solute-binding protein family 5; SPTR:
FT                   Dipeptide transport protein; PFAM: Bacterial extracellular
FT                   solute-binding proteins, family 5 Middle"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50431"
FT                   /db_xref="GOA:E6SMH1"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMH1"
FT                   /protein_id="ADU50431.1"
FT                   /translation="MSEQTLNWRRRLGAAVILALVLVAAAGIWHLAGTAGPGPAVPADP
FT                   TGAPATPPGDQPSVPELVLGSLGGFEGWNPLLTERHPLQPLLFRSLVRYNDRMEVEPDL
FT                   AASWDVSDDGRVYTLHLAEASWQDGRPVTADDVVFSLTTRLHPRADRLAAYNLAPLDGA
FT                   EAYLAELESLDREKAAGLLDEATWEARAQAAYGRWLKRGAVRAVDPRTVVVTFAEPYAP
FT                   ALELFTLPVVPAHAFASQAEALDPENPFHTGRPVGSGPYRLVSWVPGVQARLVARDDLP
FT                   AEAAPGYRVVVVRFFRDQEELDRAVLAGEVDAGRLSPEAAREVVASREPLRLVEFPDLG
FT                   YTYVAYNLRAPVLADPAVRRAIDLAVDRQAMVRDLFGRYAEPLTSPGLPGTWWAAPAPL
FT                   PRHDPEAARAVLEAAGWKDADGDGVRERGEQRLAIQLLTHRENRYREEAAAMLAASLRE
FT                   VGIAVEVRLVDWPELVAALQEGRYEAALLGVAVGVDPDGYALWHSGGHLNFTGLHDAEL
FT                   DRLLEEGRRGGDRRAVYRQVQERLVQLQPALFLWQEIQVLAVRPGVDGPISGSPGGFFW
FT                   NLAAWHPSDRQPTEPPGAGVEEPAAPARP"
     ttgtccgagc agaccctgaa ctggcgccgc cgcctggggg cggcggtgat cctcgccctg        60
     gtcctggtgg ccgcggcggg catctggcac ctggccggga ccgcgggtcc gggccccgcg       120
     gtcccggccg atccgaccgg ggcgccggcg acgccgccgg gcgaccagcc gtccgtaccc       180
     gagctggtcc tgggcagcct gggcggcttc gaggggtgga acccgctgct gaccgagcgc       240
     caccccctgc agccgctgct cttccgcagc ctggtgcggt acaacgaccg catggaggtg       300
     gagccggacc tggccgcgtc ctgggacgtc agcgacgacg gccgggtcta caccctccac       360
     ctggccgagg ccagctggca ggacgggcgg ccggtgacgg cggacgacgt ggtcttctcg       420
     ctgaccaccc gcctgcaccc ccgggcggac cggctggcgg cctacaacct ggcgcccttg       480
     gacggggcgg aggcgtacct ggcggagctg gagagcctcg accgggagaa ggccgcgggc       540
     ctgctggacg aagccacctg ggaggcccgg gcccaggcgg cctacggccg gtggctcaag       600
     cggggcgccg tacgggccgt cgacccgcgc acggtggtgg tgaccttcgc cgagccgtac       660
     gcgccggccc ttgagctctt caccctgccc gtggtgccgg cccacgcctt cgccagccag       720
     gccgaagccc tcgatcccga gaaccccttc cacaccggcc ggcccgtggg atccggaccc       780
     taccggctgg tgagctgggt gcccggcgtg caggcgcggc tggtggcccg cgacgacctg       840
     cccgcggagg cggccccggg ctaccgcgtg gtggtggtcc ggttcttccg ggatcaggag       900
     gagctggacc gggcggtgct ggcgggggag gtggacgcgg gccgcctctc gccggaggcg       960
     gcgcgggagg tggtggcgtc ccgggagccc ctgcgactgg tggagttccc cgacctcggg      1020
     tatacctacg tggcctacaa cctgcgcgcc cccgtgctgg ccgacccggc ggtccgccgg      1080
     gccatcgacc tggccgtcga tcgccaggcc atggtccgcg acctcttcgg ccggtacgcc      1140
     gaacccctga cgtcgccggg cttgccgggc acctggtggg cggcgcccgc gcccctgccc      1200
     cgccacgacc ccgaggccgc ccgcgccgtg ctggaggcgg cgggctggaa ggatgccgac      1260
     ggcgacggcg tgcgggagcg gggcgagcag cgcctggcca tccagctgct gacccaccgg      1320
     gagaaccggt accgcgagga ggcggcggcc atgctggccg cgtccctgcg cgaggtgggc      1380
     atcgccgtcg aggtccggct ggtcgactgg cccgagctgg tggccgcctt gcaggaaggg      1440
     cgctacgagg cggcgcttct cggggtggcc gtgggcgtcg atccggacgg ctacgccctg      1500
     tggcactcgg gcggccacct caacttcacc ggcctgcacg atgccgagct ggaccgcctg      1560
     ctggaggagg ggcggcgcgg cggcgaccgg cgcgccgtgt accggcaggt gcaggagcgg      1620
     ttggtccagc tgcagccggc gctgttcctc tggcaggaga tccaggtgct ggcggtgcgg      1680
     ccgggggtgg acggcccgat cagcggctcc ccgggcgggt tcttctggaa cctggcggcc      1740
     tggcatccgt ccgaccggca gccgacggag ccgccgggcg ccggggtgga ggaacctgcc      1800
     gcgcccgcgc gcccatga                                                    1818
//

If you have problems or comments...

PBIL Back to PBIL home page