(data stored in ACNUC30630 zone)

EMBL: CP002344.PE32

CP002344.PE32        Location/Qualifiers
FT   CDS_pept        27991..28221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0032"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cwo:Cwoe_1723 ATPase, P-type (transporting),
FT                   HAD superfamily, subfamily IC; SPTR: TfuA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50157"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKH0"
FT                   /protein_id="ADU50157.1"
FT                   /translation="MIRVWRPWQPVRVGDVYQPVARVLKVRKGRPTVIEIDGERYVWMP
FT                   RSMYMGPGAKHGASGGGGNRPAEGNADGMAG"
     gtgatccgcg tgtggaggcc gtggcagccg gtgcgggtcg gtgacgtata ccagccggtg        60
     gccagggtgc tcaaggtgcg caagggcagg cctacggtga ttgagatcga cggcgagcgg       120
     tacgtgtgga tgccccgtag catgtacatg gggccgggtg ccaagcatgg cgcatccggc       180
     ggcggaggca accggccggc ggagggtaac gcagatggaa tggcgggatg a                231
//

If you have problems or comments...

PBIL Back to PBIL home page