(data stored in ACNUC30630 zone)

EMBL: CP002344.PE320

CP002344.PE320       Location/Qualifiers
FT   CDS_pept        complement(374859..375695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0320"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sth:STH3143 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50445"
FT                   /db_xref="GOA:E6SMI5"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMI5"
FT                   /protein_id="ADU50445.1"
FT                   /translation="MPVPLQPIDGVKRGLAEIMTSPNPDASQPALHQGPPASGWVGPPP
FT                   APPRFPWNWAVACVLLGWGAGSLFRLRRLLGINILDMFGFWCLVGAGLCAARFFTLMQV
FT                   ADGRRRLLDALERLPGGLVKLVLPPTPHRGRGGAELLVAGENRAWVVATLDVSAAARPK
FT                   AARKHLVRAAERLAADTQTLVSELAAAGIRWTVAPQPVLVLTRRPVPGPVLEHGAWQVN
FT                   PEHVAKLFEGRTEGAQAGSSLREALLAWQRARLEGTSHRSGPAGGRAGGSAGRTRR"
     atgccggtgc cccttcaacc cattgatggc gtgaaacggg ggctcgccga gatcatgacg        60
     tcgcccaatc cggacgcttc gcaacccgca ctccatcagg ggccgccggc gtcggggtgg       120
     gtcggcccgc cgcccgcacc gccgcgtttc ccctggaact gggctgtcgc gtgcgtactc       180
     ctggggtggg gcgccggttc cctgtttcgt ctgcgccgcc tgctgggaat caacatcctg       240
     gacatgttcg gcttctggtg cctggtgggt gccggcctct gcgccgcccg gttcttcacc       300
     ctgatgcagg tggccgacgg ccggcgccgc ctgctggatg ccctggagcg cctgcccggc       360
     ggcctggtca aactggtgtt gccccctacg ccccaccgcg gccgcggcgg cgccgagctg       420
     ctggtggccg gtgaaaaccg ggcatgggtt gtggcgacgc tggacgtctc cgcggcggca       480
     cgccccaagg cggcgcgaaa gcatctggtc cgggcggccg agcggctggc cgcggatacc       540
     cagaccctgg tgtccgagct ggccgcggcc ggcatccgct ggaccgtggc gccgcaaccg       600
     gtcctggtgc tgacgcggag gccggttccc ggacccgtgc tcgagcacgg cgcgtggcag       660
     gtgaacccgg agcacgtcgc caagctcttc gaagggcgga ccgagggggc gcaggccggt       720
     tcgtccctgc gtgaggccct gctggcctgg cagcgggcac gactcgaagg gacaagccac       780
     cgttccggcc ccgccggcgg gcgcgcgggc ggaagcgccg gccggacccg ccggtag          837
//

If you have problems or comments...

PBIL Back to PBIL home page