(data stored in ACNUC30630 zone)

EMBL: CP002344.PE321

CP002344.PE321       Location/Qualifiers
FT   CDS_pept        complement(375841..376857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0321"
FT                   /product="cytochrome c class I"
FT                   /note="InterPro IPR009056: IPR003088; KEGG: sth:STH3144
FT                   hypothetical protein; PFAM: cytochrome c class I; SPTR:
FT                   Putative uncharacterized protein; PFAM: Cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50446"
FT                   /db_xref="GOA:E6SMI6"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMI6"
FT                   /protein_id="ADU50446.1"
FT                   /translation="MSKRKVVALALLWALILILQGYWLFESQRMTRASAAARDEQATRG
FT                   AQIYAQNCMVCHGPVGEGIIGPPLNREEFRAEGKTGIQVATIQDFLTKTIARGRPGFDR
FT                   NTWQIEGGKIHSYTRMPTWATSDNGPLNEQQIRDLVTFLMYGDWKEPSKYAAAPEVARL
FT                   TVTEYVTNPDTGQQEPRTRAVTAEDLDVKAAGLTDEENQEAKKLFVTMNCVQCHTLGSY
FT                   GGVVGPNLTRAGEWLPSQEFVERWIANPQAFAPWERMPSVWHGQGTPVDLTETYRKEQD
FT                   KFRSIMPAFENAMSPEQIRLLARFLMGLGDVENRNAAAAPGTTEGTGSQGQGQGGGA"
     ttgagcaagc ggaaagtggt cgctctggcc ctgctctggg cgctgatctt gatcctgcag        60
     gggtactggc tcttcgagag ccagcgcatg acccgggcgt cggcggcggc gcgggatgaa       120
     caggccaccc gcggtgccca gatctatgcc cagaactgca tggtgtgcca cggccccgtg       180
     ggcgagggga tcatcggccc gcccctgaac cgggaggaat tccgcgccga gggcaagacc       240
     ggcattcagg tcgccacgat tcaggatttc ctgaccaaaa ccatcgcccg cggccgaccc       300
     ggcttcgatc gcaacacctg gcagatcgag ggcggcaaga tccactcgta cacgcgcatg       360
     cccacctggg cgacctcgga caacgggccg ctgaacgagc agcagattcg cgacctggtc       420
     accttcttga tgtacggcga ctggaaggag cccagcaagt acgcggccgc ccctgaggtg       480
     gcacggctca ccgtgacgga gtacgtcacc aaccccgaca cgggtcagca ggaaccccgc       540
     acccgggccg tcaccgccga ggacctggac gtgaaggccg ccggattgac ggatgaggag       600
     aaccaggagg ccaagaagct tttcgtcacg atgaactgcg tccagtgcca caccctcggc       660
     agttacggcg gcgtggtcgg ccccaacctg acccgagccg gcgagtggct gccgagccag       720
     gagttcgtcg agcggtggat cgccaacccc caggccttcg cgccctggga gcggatgcct       780
     tcggtgtggc acggtcaggg cactccggtg gacctgacgg agacctaccg caaggagcag       840
     gacaagttcc gcagcatcat gccggccttc gagaacgcca tgtcgcccga acagatccgc       900
     ctcctggccc ggttcctcat gggcctgggt gacgtggaga accgcaatgc cgccgcggca       960
     cccggtacca ccgaggggac cggtagccag ggccagggcc agggcggcgg cgcgtga         1017
//

If you have problems or comments...

PBIL Back to PBIL home page