(data stored in ACNUC30630 zone)

EMBL: CP002344.PE340

CP002344.PE340       Location/Qualifiers
FT   CDS_pept        397186..400212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0340"
FT                   /product="S-layer domain-containing protein"
FT                   /note="InterPro IPR001119; KEGG: dsy:DSY3329 hypothetical
FT                   protein; PFAM: S-layer domain-containing protein; SPTR:
FT                   S-layer domain protein; PFAM: S-layer homology domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50465"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG48"
FT                   /protein_id="ADU50465.1"
FT                   /translation="MSSVHRQHSRKFAVIVTVLALLLGLFPVAAFASHGQFPDVSGVLA
FT                   GEIKAAHDAGLVDGYDDGTFRPNENVTRAAFAKFIVLAVEKATGQSLPTGDEPFSDVAP
FT                   NQALYEYVVKAYKAGYIQGYSDGTFGYDKPINRQEAAAILQRALKLADAPENFADVPDD
FT                   SAFAKAIGAVAAAGLMKGYDNGNFGPSDKVNRAQAAAVAVRGYNHLAQQNVQYEVVSVA
FT                   AVSSKALRVTFNKAVDDTSKVKFDVKRDGVAVDLTAKWAEDKKSVDLESSSKLQVGTYT
FT                   VTVSGLDFAEGKNSGSVKVEEETVAKIEIVGDKLIRDKNTPSVARIGYKVYNQYGEDIT
FT                   NSSVAAGIEAKSSAGSASITSTGVVEITNNPSNQAWPLDAKVVLTLVHSATGVTASKTL
FT                   TVADSGQLTSFAFGNIIYPDDSKRIYTGRSEAAWIEVQATDANGQPADEAYLRNAVTLV
FT                   PQSGLQADFATRDGKPVIKIDTTSIVTAGKYTLTAVVLSSPDLNKSITLDVVKEPYPAK
FT                   VELSAPEGLVAARDAAGTVVLGLKVYDQFGNEMAGKDVAAHSADIEVRAVGAGFASGAN
FT                   VDVFGIATTGANIGKVVNTDVIPALASGNAGTITVFATAKETGNTSTVQFQVRPEREPA
FT                   AVVLPTDAVTNLLYNASSVVSLNFKDQYEANYDPAKADPAGAVQSFGYKVTLSGQDVVT
FT                   VTVGGVTLDLGAAPAVSEAAKNGTAGTPATSVLVDLKNITLQAKSASGNATVTVQLLKG
FT                   SNVVSSVQFNVSVAAPSSTLQYSLAQIPALYWDADGDPTNNSGTTNGGSATAAYAEEIR
FT                   VVAKDSTGKTYTVAPSTIVVATVDGADFETGKDGNVWKVWSTRTQRPTDKVTGTLTVQV
FT                   QTTDAGLVTLTGTVTISNEDRYAVNVLVRDAGLTSPNGSVSLPANSNPVSEATYDTAAT
FT                   PPSLTPKPYVAVEDQFGRYWVPGNLKLAPANVSLGVTVTDVSYAATGEVTVSASGAGTF
FT                   DVVIQAPNGKTATIKVNVR"
     ttgagttccg ttcatcggca gcactcccgc aagttcgcgg tgatcgtgac ggtcctggcc        60
     cttttgttgg gcttgttccc ggtcgccgcg ttcgccagcc acggccagtt ccccgacgtg       120
     agcggtgtgc tggccggcga gatcaaggcg gcccatgacg cgggtctggt ggacggctac       180
     gacgacggca cgttccggcc caacgagaac gtgacccggg cggccttcgc caagttcatc       240
     gtcctggccg tcgagaaggc tacgggccag tccctgccga cgggtgacga gcccttctcc       300
     gacgtggccc ccaaccaggc tctgtacgag tacgtggtca aggcctacaa ggcgggttac       360
     atccagggct acagcgacgg caccttcggg tacgacaagc ccatcaaccg ccaggaggcc       420
     gcggccatcc tgcagcgggc cctgaagctg gccgacgccc cggagaactt cgccgacgtg       480
     cccgatgaca gcgccttcgc caaggcgatc ggcgcggtgg cggccgccgg cctgatgaag       540
     ggctatgaca acggtaactt cggccccagc gacaaggtga accgggccca ggcggcggcg       600
     gtggcggttc gtggttacaa ccatctcgcg caacagaacg tccagtatga ggttgtctcg       660
     gtcgctgccg tcagctccaa ggccttgcgc gtgacgttca acaaggctgt ggacgacacg       720
     agcaaggtca agttcgacgt gaagcgggac ggcgtagccg tcgacttgac ggcgaagtgg       780
     gctgaggaca agaagtccgt ggaccttgag tcgtcgtcca agctgcaggt tggaacctac       840
     acggtgacgg tcagcggcct cgactttgcc gagggcaaga acagcggctc ggtcaaggtc       900
     gaggaagaga cggtcgccaa gattgagatc gttggcgaca agctgatccg ggataagaac       960
     accccctctg tcgctcgcat tggctacaag gtgtacaacc agtacggcga ggatatcacg      1020
     aactcgtcgg tggcggcggg gattgaggcg aagtccagcg ctggtagcgc gagtataaca      1080
     agcaccggtg tcgtcgagat taccaacaac cccagcaatc aggcgtggcc gcttgatgcc      1140
     aaggtcgtgc tcacgctggt ccactccgct accggcgtta cggcgagtaa gacgctgacg      1200
     gtggccgatt ccggtcagct gaccagcttc gcatttggta acatcatcta tccggatgac      1260
     tcgaagcgta tctatactgg tcgttcggag gctgcctgga ttgaggttca ggccacggac      1320
     gccaatggtc agcctgcgga cgaggcgtac cttcggaacg ctgtgactct cgttccgcag      1380
     tcgggccttc aggcagactt cgctacgagg gacggtaagc ctgtcatcaa gatcgatacg      1440
     accagtatcg tgacggcggg taagtacacc cttacggctg ttgttctaag ctcgcccgac      1500
     ctcaacaagt ccatcactct ggacgtggtg aaggagccgt acccggcgaa ggtcgagttg      1560
     tccgcaccgg aagggcttgt agcggctcgg gacgcggctg gaacggtcgt ccttggtctc      1620
     aaggtctatg accagtttgg caacgagatg gcgggcaagg acgttgcggc ccacagcgcg      1680
     gacattgagg tgcgggctgt gggtgccgga ttcgcttccg gcgccaacgt ggatgtcttc      1740
     ggtatcgcaa ccacaggtgc caatatcggc aaggttgtca acactgatgt cattccggcg      1800
     ttggcttccg gtaatgcggg taccattacg gtgttcgcaa cggcgaagga gaccgggaac      1860
     acctccaccg tgcagttcca ggttcggccc gagcgtgagc cggcggccgt ggtcctgccg      1920
     actgacgcag taaccaacct gctgtacaac gcgagctctg tcgtgagcct gaacttcaag      1980
     gatcagtacg aggcgaacta cgatcctgcc aaggctgatc ctgcgggggc cgtacagagc      2040
     tttggctaca aggtgacttt gagtgggcag gatgtggtca ctgttaccgt cggcggggtt      2100
     acgctggacc tcggtgccgc gcccgctgtg tcggaggctg cgaagaacgg tactgcaggt      2160
     actcccgcga caagcgtgct agtcgacctg aagaacatta ccctgcaggc gaagtcggca      2220
     agcggtaatg cgactgtgac ggtacagttg ctgaagggta gcaatgtggt aagctcggtg      2280
     cagttcaacg tctccgtcgc ggcgccgtcc agcacgctgc agtacagctt ggctcagatt      2340
     ccggccctgt actgggatgc ggatggcgac ccgactaaca attcgggcac taccaatggc      2400
     ggctctgcta cggcggcgta cgccgaggag atccgggttg tcgccaagga cagcaccggc      2460
     aagacttaca ctgtagcgcc gtcgaccatc gtcgttgcga cagtggacgg agccgacttt      2520
     gagaccggca aggacggcaa cgtgtggaag gtgtggtcga cccgcacgca gcgtcccacc      2580
     gataaggtga ccggcacgct cacggtgcag gttcagacca ccgatgccgg cttggtgacg      2640
     ctgaccggca cggtgacgat ctccaacgaa gatcggtatg ccgtgaacgt gctggtacgt      2700
     gacgcggggc tgacgtcgcc gaacggaagc gtcagcttgc cggctaatag taatccggtg      2760
     agcgaggcaa cgtatgacac tgcggcgacc ccgccgtcgc ttacgccgaa accgtacgtg      2820
     gcggtggagg atcagttcgg ccgctactgg gtgcctggga atctgaagct ggctcctgcg      2880
     aatgtgtcgc taggggtcac ggtgaccgac gtgtcgtacg cggcgaccgg tgaggtgact      2940
     gtcagcgcgt cgggcgctgg tacgttcgac gtcgtcatcc aggcgccgaa cggcaagacc      3000
     gctacgatca aggtgaacgt tcggtag                                          3027
//

If you have problems or comments...

PBIL Back to PBIL home page