(data stored in ACNUC30630 zone)

EMBL: CP002344.PE342

CP002344.PE342       Location/Qualifiers
FT   CDS_pept        402702..404006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0343"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcz:pE33L466_0247 transposase; SPTR:
FT                   Transposase; manually curated; PFAM: Transposase
FT                   IS116/IS110/IS902 family; Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50467"
FT                   /db_xref="GOA:E6SG50"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG50"
FT                   /protein_id="ADU50467.1"
FT                   /translation="MTGRERTDNAPRTYVGIDVGRRRHRAAILPIGRAMHGWEHAPVLA
FT                   FTADTDGFREFFDALHAAGATPANTVCALEPTGGYSSQPIFQALKHHGFEVLWVKNQAV
FT                   HDLRETLYGRRSKTDAEDARLIARLLYLREAIGQEYAFQVAHTGSAPYRNLRLLVELRW
FT                   KQVQAHRRASNQLMQVLDVLFPEMRQIFRKGTTRPTPLHLLRRFSTVQAIAAASEQDLR
FT                   HVLVNEARSLRHQTAVSELRRLAQTSVGAREGRDVLELAQGWLIQQLHDLQDSLVDLEA
FT                   RIKAAVEEFPETSILRTFPSMSARRIATLLAGMGAPIDAFPNDRALRKQWGWYVEIEQS
FT                   GARTRSRLGRGGYRGTRRELYLMAMQLIKEQTQDNPFRHYYRRLLRGNPTPKVPKVALG
FT                   HVASKLITVMYVCMRRREPYDPAKLWRHMGVKTTA"
     ctgaccggga gggagaggac ggacaatgct ccccgtacct atgtaggcat cgatgtcggg        60
     cggcggcgtc accgggctgc gatcttgccc atcgggcgag ccatgcacgg gtgggagcac       120
     gccccggtgc tcgcctttac ggcggacacc gacggtttcc gcgagttctt cgatgctctc       180
     cacgcagccg gcgccacgcc tgccaacacc gtgtgcgcac tggaaccgac cggcggctac       240
     tcctcacagc ccatcttcca ggccctcaag caccacggtt tcgaggtcct ctgggtcaag       300
     aaccaggccg tgcatgacct gcgggaaacg ctgtacggtc gccgatcgaa gaccgacgcg       360
     gaagacgcac ggctcattgc ccggctgctg tatctacgcg aggcgatcgg ccaggagtac       420
     gcgttccagg tggcccacac ggggagtgca ccctaccgaa accttcgtct cctcgtggag       480
     ctgcgttgga aacaggtgca agcgcaccgg cgggcatcga accaactgat gcaggtgctg       540
     gacgtgctgt ttcccgagat gcggcagatc ttccggaagg gaaccacacg cccgacgccg       600
     ctccatctcc tccgccgttt ctcgacggtg caggccatcg ccgccgcgtc cgagcaggat       660
     ctacgccacg tcctggtcaa cgaggcccgc agcctacgcc atcaaaccgc cgtatcggaa       720
     ctccgccggc tggcccagac cagcgtcgga gcccgtgaag gccgggacgt gttggagctg       780
     gcccaggggt ggctgatcca gcagctccac gacttgcagg attccctggt ggacctcgag       840
     gcccggatta aagccgcagt agaggaattc cccgaaacct cgatcctacg tactttcccc       900
     tccatgtcgg ctcgtcggat tgccacgttg ctagccggaa tgggggctcc gattgacgcg       960
     tttcccaacg accgggcctt gcggaagcag tggggatggt acgtggagat cgagcagtcg      1020
     ggtgcacgca cgcgctcccg cctcggccgg ggcgggtacc gcggtacgcg ccgagaactc      1080
     tacctgatgg cgatgcagct catcaaggag caaacccagg acaacccgtt ccggcactat      1140
     taccggcgcc ttctgcgggg taaccccacg cccaaggtac cgaaggtggc cctcggccac      1200
     gtggcctcca agctcatcac cgtgatgtac gtgtgtatgc gacgccgcga accctatgac      1260
     ccggccaagc tctggagaca catgggggtg aagacaacgg cttag                      1305
//

If you have problems or comments...

PBIL Back to PBIL home page