(data stored in ACNUC30630 zone)

EMBL: CP002344.PE362

CP002344.PE362       Location/Qualifiers
FT   CDS_pept        422798..423163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0364"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dre:386635 v-erb-b2 erythroblastic leukemia
FT                   viral oncogene homolog 3a; SPTR: Novel protein similar to
FT                   ErbB (V-erb-b erythroblastic leukemia viral oncogene
FT                   homolog, neuro/glioblastoma derived oncogene homolog)"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50487"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG70"
FT                   /protein_id="ADU50487.1"
FT                   /translation="MYPEEYRYAKWPEAYATNFPGTAYLNTQASDDETEENWTVGTLDA
FT                   GEFEPYVQYYADIIGSPDYPGTNWWKLYFELGVIDAPLCGITVSPEWCMLYPHDRYMRI
FT                   PFTYHYTFPGGIYWYGQ"
     gtgtaccccg aggaataccg ctacgccaag tggccggaag catatgctac gaactttcct        60
     ggcactgcat atctcaacac ccaggcttct gacgacgaaa cggaggaaaa ctggacggtc       120
     ggcaccctag acgcggggga gtttgagccc tatgtacaat actacgccga catcatcggc       180
     agtccagact acccgggcac gaactggtgg aagctgtact tcgaactagg ggtcatcgat       240
     gctcctcttt gcggcatcac cgtttcgccc gaatggtgca tgctctaccc gcacgaccga       300
     tacatgcgaa tcccgttcac gtatcactat acgttcccag gtggtatata ctggtacggg       360
     cagtga                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page