(data stored in ACNUC30630 zone)

EMBL: CP002344.PE368

CP002344.PE368       Location/Qualifiers
FT   CDS_pept        428050..431787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0370"
FT                   /product="DNA polymerase III catalytic subunit, DnaE type"
FT                   /EC_number="2.7.7.7"
FT                   /note="COGs: COG0587 DNA polymerase III alpha subunit;
FT                   InterPro IPR006162: IPR003141: IPR004805: IPR004013: IPR
FT                   011708: IPR004365; KEGG: hmo:HM1_0084 DNA polymerase III
FT                   alpha subunit, putative; PFAM: DNA polymerase III alpha
FT                   subunit; PHP domain protein; nucleic acid binding OB-fold
FT                   tRNA/helicase-type; PRIAM: DNA-directed DNA polymerase;
FT                   SMART: phosphoesterase PHP domain protein; SPTR: DNA
FT                   polymerase iii alpha subunit, putative; TIGRFAM: DNA
FT                   polymerase III, alpha subunit; PFAM: PHP domain; Bacterial
FT                   DNA polymerase III alpha subunit; OB-fold nucleic acid
FT                   binding domain; TIGRFAM: DNA-directed DNA polymerase III
FT                   (polc)"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50493"
FT                   /db_xref="GOA:E6SG76"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="InterPro:IPR041931"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG76"
FT                   /protein_id="ADU50493.1"
FT                   /translation="MQPFVHLHVHSEYSLLDGAARVGELAARAAELGMPALALTDHGVM
FT                   YGAIDFYKACKKHGIKPIIGCELYLARRTRHDREPKVDDQSYHLLALAQNETGYRNLIK
FT                   IVSRAYAEGFYYKPRADKELLAEHSEGLIVTSGCIGSEIPRLLLEGREEEALKAVRWYL
FT                   EVFGDRFYFEIQDHGIPEERRAYARILELARRFDVPVVATNDVHYLHKDDAAAHEVLLC
FT                   IQTGKTLDDPHRMRFDGAEFYLKSPEEMAALFRDVPEALANTVQLAERCQLEFEFGRFL
FT                   LPHYEVPEGHDAASYLRYLCETKLPERYPDAGSEVWDRLNHELAVITRMGYPAYFLIVW
FT                   DFVDYARRNGIAVGPGRGSAAGSLVAYVLGITDIDPLRYNLLFERFLNPERVTMPDIDI
FT                   DFDDHRRDEVIDYVVRKYGRDRVAQIITFGRMLARAVIRDVGRVMGLPYGEVDKIAKMV
FT                   PAQLGITLDQALEASPELKQAYEQQPVVRQLVDMARKLEGMPRHASVHAAGVVIGRDPL
FT                   MEHVPLQRMQDGSTVTQFPMTTLEELGLLKMDFLGLRTLHVIQETEAIINTTGARDVLA
FT                   GESGGGGAEEPGAAPRFRVRDIPLDDPATFEAMSRGDTAAMFQVESSGFTQMLRSLRPS
FT                   SIEDLIAAVALFRPGPLGSGMVDDFIKRKHGQVPVEYPHPWLEPILKETYGTIVYQEQV
FT                   MQIASVMAGFTLGEADLLRRAMGKKKPEEMQKQREKFLAGAEAKGVDRKLAEHIFDLME
FT                   YFAGYGFNKSHSAAYGYLAYVTAYLKTHYPAPYMAATLSSVMSNSDRVAEYIGECRRLG
FT                   IPVLPPDINESQALFTVVPDPRAPGGQAIRFGLAAVKNVGFGAIESIVSAREQGGPFRS
FT                   LDDFCRRVDLRQVNRRALESLIKAGAFDSLGHPRARLLAGLEEVMERAQRWQKERETGQ
FT                   VSLLDLTAALVGAGGGSGAPGAAGAAAGAGAPEGFGSRAGGGRRRGKGAAPGGGAGASG
FT                   RTGAGAADPGGAGGLGPAGAGNGHDPARAAASLWGDEATELPPVEEWPPNRKLAMEKEV
FT                   LGLYLSGHPLAHYQRELARRVTATTRQLAEREDGARVQVGGLVQGVRRITTRSGELMAF
FT                   VQLEDLEGSVEVVVFPRTYGEAAEALQEDAVIVVRGRVDRREEEEPPKVVAEEIWPLVT
FT                   GKRLVVALPGGGPDAVEGVLARVRGACQRHPGTSPVVLVFPGREHALQVDAQYWVTPRA
FT                   ELFQDLARVVGDNGFYLDDH"
     atgcagccct tcgtccacct gcacgtccac agcgagtaca gcctgctgga cggtgccgcc        60
     cgcgtgggcg agctggccgc ccgggcggcg gaactgggca tgcccgccct ggccctgacg       120
     gaccacggcg tcatgtacgg ggccatcgac ttctacaagg cgtgcaagaa gcacgggatc       180
     aagcccatca tcggctgcga gctctacctg gcgcggcgca cccgccacga ccgggagccg       240
     aaggtggacg accagtccta ccacctgctg gccctggcgc agaacgagac ggggtaccgc       300
     aatctgatca agatcgtctc ccgggcctac gccgaggggt tctactacaa accgcgggcc       360
     gacaaggagc tgttggccga gcacagcgag gggctgatcg tcacctcggg ctgcatcggc       420
     agcgagatcc cgcggctgct cctggagggg cgggaggaag aggccctcaa ggccgtccgc       480
     tggtacctgg aggtcttcgg cgaccggttc tacttcgaga tccaggacca cggcatccct       540
     gaggaacgcc gggcctacgc ccgcatcctg gagctggccc ggcgcttcga cgtgcccgtg       600
     gtggcgacca acgacgtcca ctacctgcac aaggacgacg ccgccgccca cgaggtgctg       660
     ctgtgcatcc agacgggcaa gaccctggac gatccccacc gcatgcgctt cgacggggcc       720
     gagttctacc tgaagagccc ggaggagatg gcggccctgt tccgcgacgt gcccgaggcc       780
     ctggccaata ccgtccaact ggccgagcgc tgccagctgg agttcgagtt cggccggttc       840
     ctgctgcccc actacgaggt gccggagggg cacgatgccg catcctacct gcgctacctg       900
     tgcgagacca agctgcccga gcgctacccc gacgccggca gcgaggtgtg ggaccggctg       960
     aaccacgagc tggcggtcat cacccgcatg ggctacccgg cctacttcct catcgtgtgg      1020
     gacttcgtcg actacgcccg gcgcaacggc atcgccgtgg gaccgggccg cggctcggcg      1080
     gcgggcagcc tggtggccta tgtgctgggg atcaccgaca tcgacccgct gcggtacaac      1140
     ctgctcttcg agcggttcct caaccccgag cgggtgacca tgcccgacat cgacatcgac      1200
     ttcgacgacc accggcggga tgaggtcatc gactacgtgg tccgcaagta cggccgcgac      1260
     cgggtggcgc agatcatcac cttcggccgc atgctggccc gggcggtgat ccgcgacgtg      1320
     ggccgggtca tgggcctgcc ctacggcgag gtcgacaaga tcgccaagat ggtgccggcg      1380
     cagctgggca tcaccctgga ccaggcgctg gaggcgagcc ccgagctgaa gcaggcctac      1440
     gagcagcagc ccgtggtgcg ccagctggtg gacatggccc gcaaactgga gggcatgccg      1500
     cgccacgcct cggtccacgc cgccggcgtg gtgatcggcc gcgaccccct gatggagcac      1560
     gtgcccctgc agcgcatgca ggacggctcc accgtcaccc agttccccat gaccaccctg      1620
     gaggaactgg gcctgctgaa gatggacttc ctcggcctgc gcaccctgca cgtgatccag      1680
     gagaccgagg cgatcatcaa caccacgggg gcgcgggacg tgctggcagg cgaatccggt      1740
     ggcggcgggg cggaggaacc cggcgccgcc ccccggttcc gggtgcggga catccccctg      1800
     gacgacccgg ccaccttcga ggcgatgagc cggggcgaca ccgccgccat gttccaggtg      1860
     gagtcgtcgg gcttcaccca gatgctgcgg tccctgcggc cctccagcat cgaagacctg      1920
     atcgccgccg tggccctgtt ccgtccgggc cccctgggca gcggcatggt ggacgacttc      1980
     atcaagcgca agcacggcca ggtgcccgtg gagtacccgc acccgtggct cgagccgatc      2040
     ttgaaagaga cctacgggac catcgtctac caggagcagg tcatgcagat cgccagcgtc      2100
     atggccggct tcaccctggg cgaggccgac ctgctgcgcc gggccatggg caagaagaag      2160
     cccgaagaga tgcagaagca gcgggagaag ttcctggccg gtgcggaggc caagggcgtc      2220
     gaccgcaagc tggccgagca catcttcgac ttgatggagt acttcgccgg gtacgggttc      2280
     aacaagagcc actcggccgc ctacggctac ctggcctacg tgacggcgta cctcaagacc      2340
     cactacccgg cgccctacat ggccgccacc ttgagcagcg tgatgagcaa ctccgaccgg      2400
     gtggcggaat acatcggcga gtgccggcgc ctgggcatcc ccgtgctgcc gccggacatc      2460
     aacgagagcc aggccctgtt caccgtggtc cccgaccccc gggcgccggg cggccaggcg      2520
     atccgcttcg gcctggcggc ggtgaagaac gtggggttcg gcgccatcga gtccatcgtg      2580
     agcgcccggg agcagggcgg gcccttccgc tccctggacg acttctgccg ccgggtcgac      2640
     ctgcgccagg tcaaccgccg ggccctggag agcctgatca aggccggcgc cttcgacagc      2700
     ctgggccacc cgcgggcacg cctgctggcc ggcctggaag aggtcatgga gcgggcccag      2760
     cgctggcaga aggagcggga gacgggccag gtgtccctgc tggacctgac ggcggccctg      2820
     gtgggggcgg gcggcgggtc cggggcaccc ggtgcggccg gtgcggccgc gggcgcgggg      2880
     gcgcccgagg gcttcgggtc ccgagccgga ggcggccggc ggcgggggaa gggcgcggcc      2940
     cccggcgggg gggccggtgc gtcgggacga accggcgccg gggcggccga ccccggcgga      3000
     gccggcggcc tcgggccggc gggggccggc aacggccacg acccggcccg ggcggccgcg      3060
     tccctctggg gcgatgaggc caccgagctg ccgccggtgg aggagtggcc gcccaaccgc      3120
     aagctggcca tggagaagga ggtcctgggg ctgtacctct cgggccatcc cctggcccac      3180
     taccagcggg agctggcccg gcgggtgacg gccaccaccc gccagctggc ggagcgggaa      3240
     gacggcgccc gcgtccaggt gggcggcctg gtgcaggggg tccggcggat caccacccgc      3300
     agcggcgagc tcatggcctt cgtccagctg gaagacctgg aggggtccgt ggaggtggtg      3360
     gtcttcccgc ggacctatgg cgaggcggcg gaggcgttgc aggaggacgc ggtgatcgtc      3420
     gtccggggcc gggtcgaccg gcgcgaggag gaagagccgc ccaaggtcgt ggccgaggag      3480
     atctggccgc tggtgacggg caagcggctg gtggtggccc tgccgggcgg cggccccgac      3540
     gcggtggaag gggtcctggc gcgggtccgc ggcgcctgcc agcggcaccc gggcacgtcg      3600
     ccggtggtgc tggtcttccc cgggcgggag cacgccctgc aggtcgatgc ccagtactgg      3660
     gtgacgccgc gggccgagct cttccaggac ctggcccgcg tggtgggcga caacgggttc      3720
     tacctggacg accactga                                                    3738
//

If you have problems or comments...

PBIL Back to PBIL home page