(data stored in ACNUC30630 zone)

EMBL: CP002344.PE38

CP002344.PE38        Location/Qualifiers
FT   CDS_pept        33041..34471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0038"
FT                   /product="phage prohead protease, HK97 family"
FT                   /note="InterPro IPR006433; KEGG: sro:Sros_3378 hypothetical
FT                   protein; PFAM: peptidase U35 phage prohead HK97; SPTR:
FT                   Mu-like prophage I protein-like protein; TIGRFAM: phage
FT                   prohead protease, HK97 family; PFAM: Caudovirus prohead
FT                   protease; TIGRFAM: phage prohead protease, HK97 family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50163"
FT                   /db_xref="GOA:E6SKH6"
FT                   /db_xref="InterPro:IPR006433"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKH6"
FT                   /protein_id="ADU50163.1"
FT                   /translation="MPTRGYPTEFKTVSFSLTRFDESAGTVEGYASTWDRDEDGDVIVK
FT                   GAFKKTIQERVPAGKVKLLDSHRWDSQHVLGTVVEAREEDHGLWIKAIFSGSAEAQAVR
FT                   QKVLEGHLTAFSIGFESLRDEIKADEQGRPTRYIYEVKLYEVSIVPFPANENAVIMAAK
FT                   QANGSGRAGMDKPIEPLFPPGTRVRLLVPPHIEGQPTEAIVREAVVGVAYGLLFEGDST
FT                   IHRWYVESELAPADGGQAEGHSAGHKYKGVVPFQDLPLADRDRPWDADAAVQRVRRWAS
FT                   RDGSGEKDTIDWARYRRAFVWYDSSNAEHFGSYKLPVADVIDGQLRAVPRAIFAAAAAV
FT                   QGARGGVDIPASDLPAVRNHLARYYRKMGETPPWEQDSLDLIVAEVKAGRRNSQADFER
FT                   IAGAISLLWEALNDDEKAQVMERLGLAPAAGPDETPPTDGGEVKGEATEPPTEDASALM
FT                   AALEVLDAELDLLETEVA"
     atgccgaccc gcggttaccc cacggagttc aagacggtgt ccttctcgtt gacgcgcttc        60
     gacgagagcg cgggcaccgt tgagggctac gcctccacgt gggaccgcga cgaggacggg       120
     gacgtgatcg tcaagggtgc cttcaagaaa acgattcagg agcgggtacc ggcgggcaag       180
     gtcaagctac tggattccca ccgctgggac tcgcagcacg tccttggcac cgtcgtcgag       240
     gcccgcgagg aggatcatgg cctttggatc aaggcgattt tctcaggttc cgccgaggcg       300
     caggccgtca ggcagaaggt gctggaggga cacctgaccg ccttcagtat cggcttcgag       360
     agcttgcggg acgagatcaa ggctgacgag cagggacggc cgacccgcta tatctacgag       420
     gtcaagttgt acgaggtcag cattgtgccg ttcccggcaa acgaaaatgc ggtcataatg       480
     gcggccaagc aggctaacgg ctccggcagg gcagggatgg ataagccgat cgagcctttg       540
     ttcccgcccg ggaccagagt ccgcctgctg gtgccgccac acatcgaggg acagcccacc       600
     gaggcgattg tgcgagaggc cgtcgtcggt gttgcctacg ggctcttgtt cgagggcgac       660
     agcacgatcc atcgctggta cgtagagtcc gagctggcgc cagccgacgg gggccaagcg       720
     gaggggcaca gtgcgggtca caagtacaag ggcgtcgtgc cattccagga cctgcccctg       780
     gctgatcgcg accgcccctg ggacgccgac gcagccgttc aacgggtccg ccggtgggca       840
     tcccgggatg ggagtggcga gaaggacacg atcgactggg cccgctacag gcgggccttt       900
     gtttggtacg acagctccaa cgcggagcac ttcggcagct acaagttgcc cgtcgcggac       960
     gtcatcgacg gccagcttcg cgcggttccc cgcgcgattt ttgctgccgc ggcggctgtg      1020
     cagggcgctc ggggaggggt ggacatcccc gcgagcgacc tgccggccgt ccgaaaccac      1080
     ctggcccggt actaccgcaa gatgggcgag acgccgccct gggagcaaga cagcctggac      1140
     ttgatcgtgg ccgaagtgaa ggccgggcgg cgcaacagcc aggcggactt tgaacggatt      1200
     gccggggcga tttcgctgct ctgggaggcg ctgaatgacg acgagaaggc gcaggtcatg      1260
     gagcgtctgg gccttgcccc tgcggccggg ccggatgaga ctccacccac cgacgggggc      1320
     gaggtaaagg gcgaggccac cgagccgccg acggaggatg cgtcggcact catggcggcc      1380
     ctggaggttc tggacgccga actggacctg cttgagacgg aggtggcatg a               1431
//

If you have problems or comments...

PBIL Back to PBIL home page