(data stored in ACNUC30630 zone)

EMBL: CP002344.PE384

CP002344.PE384       Location/Qualifiers
FT   CDS_pept        complement(450094..451194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0386"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="COGs: COG2514 ring-cleavage extradiol dioxygenase;
FT                   InterPro IPR004360; KEGG: tro:trd_1850 glyoxalase family
FT                   protein; PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; SPTR: Glyoxalase family protein; PFAM:
FT                   Glyoxalase/Bleomycin resistance protein/Dioxygenase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50509"
FT                   /db_xref="GOA:E6SG92"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG92"
FT                   /protein_id="ADU50509.1"
FT                   /translation="MNHSPTPQAALPADIRLGPVYLRVRQLARVLPFYRDLLGLVPSPA
FT                   PGVAGSTAGAASQGGAGTPGGAAAGDAGRVGTADHAGGLGRTGDAGVPEGSQSPAGPPR
FT                   PVASAPGNGSSHPPVWLAAAAGGPPLLCLEESPGAPPRPPRTTGLYHVALLYPGRADLA
FT                   RAFLRLVQGRWRFQGFADHGVSEAIYLADPEGNGLELYADRPRDQWPRRNGGIAMYTAP
FT                   LDLEDLVAAAGGTRPDAGPDGAGDPPRGPVVGHVHLQVSRLQTVEAFYCGVLGFEVTQR
FT                   DFPGALFVAAGGYHHHLGLNVWAGEGAPPPPPGAAGLAGFTIQLPTAADLKAVLDRARA
FT                   AGHEAEPSPRGWVLRDPDGIPVFLTT"
     atgaaccatt ccccaacgcc gcaggccgca ttgcctgccg acatccggct cgggccggtg        60
     tacctgcggg tccgccagct ggcccgcgtg ctgccgttct accgcgatct tctgggtctc       120
     gtgcccagcc cggctcccgg ggtggccggc tccacggccg gggccgcgtc ccaaggaggg       180
     gcgggcacgc ccgggggcgc ggctgccggg gacgcgggcc gcgtcgggac agcggaccac       240
     gcggggggcc tcggccgcac aggggacgca ggggttcccg aaggcagcca gagccccgcc       300
     ggcccacccc gcccggttgc gagcgcccct gggaacgggt cgtcccaccc gccggtctgg       360
     ctcgccgctg cagccggcgg ccctcccctc ctctgcctcg aagagtcgcc cggcgccccg       420
     ccgcgcccgc cgcgcaccac gggcctgtac cacgtcgccc tgctctaccc cggccgggcg       480
     gacctggccc gcgccttcct gcgactggtg caggggcggt ggcgctttca gggcttcgcc       540
     gatcacggcg tgagcgaggc catctacctg gccgaccccg aaggcaacgg cctcgagctc       600
     tacgccgacc ggccgcggga ccagtggccg cgccggaacg gtgggatcgc catgtacacc       660
     gcgccgctgg acctggagga cctggtcgcc gccgccggag gaacccggcc ggacgccggc       720
     ccggacgggg ccggggaccc tccccggggg cccgtggtcg ggcacgtcca cctgcaggtc       780
     tcccggctgc agaccgtcga ggcgttctac tgcggggtac tgggcttcga ggtcacccag       840
     cgggacttcc ccggcgccct cttcgtggcg gccggcggat accaccatca cctgggcctc       900
     aacgtctggg cgggcgaagg cgcccccccg ccgccgcccg gagccgccgg cctggcaggg       960
     ttcaccatcc agctacccac cgcagcggac ctgaaggcgg tgctggaccg cgcccgggcc      1020
     gcagggcacg aggccgagcc ctcaccccgt ggctgggtcc tccgcgatcc cgacgggatc      1080
     ccggtctttc ttaccacgtg a                                                1101
//

If you have problems or comments...

PBIL Back to PBIL home page