(data stored in ACNUC30630 zone)

EMBL: CP002344.PE386

CP002344.PE386       Location/Qualifiers
FT   CDS_pept        453669..454565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0388"
FT                   /product="band 7 protein"
FT                   /note="COGs: COG0330 Membrane protease subunits
FT                   stomatin/prohibitin homologs; InterPro IPR001107; KEGG:
FT                   gwc:GWCH70_0387 band 7 protein; PFAM: band 7 protein;
FT                   SMART: band 7 protein; SPTR: Band 7 protein; PFAM: SPFH
FT                   domain / Band 7 family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50511"
FT                   /db_xref="GOA:E6SG94"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG94"
FT                   /protein_id="ADU50511.1"
FT                   /translation="MKETRAWALPGIVGLVLALALGGAAVYLFIRGVSALESGAVPVLG
FT                   HGGVDVTAGVLALIAAIIVASGMLIVQPNYSRSVVFLGRYLGTLREPGWWWTVPLTSQP
FT                   AVSLRVRNFESEKIKVNDLRGNPIQIAAVVVWRVVDAARALFEVDKYEEFVKIQSETAL
FT                   RHIASQYPYDTFEDHSATSLRENTDIVSQALAQELQERLAVAGVEVLDARLTHLAYAPE
FT                   IAHAMLQRQQAEAVVAARAKIVEGAVGMVQMALAELQRHGVVELDDERRAAMINNLMVA
FT                   IVGERAAQPVINTGTLY"
     atgaaggaga cccgggcgtg ggcgctaccc ggcatcgtgg gactggtgct ggcgctggcg        60
     ctgggtgggg ccgcggtgta cctgttcatc cgcggggtgt cggcgctgga gagcggtgcg       120
     gtgccggtgc taggccacgg cggcgtcgac gtgacggccg gtgtcctcgc gctgatcgcg       180
     gccatcatcg tcgcgtcggg catgttgatc gtccagccca actactcccg gtcggtggtg       240
     ttcctgggcc ggtacctggg gaccctgcgg gagcccggct ggtggtggac ggtgcccttg       300
     accagccagc cggccgtctc cctgcgggtg cgcaacttcg agagcgagaa gatcaaggtc       360
     aacgacctgc gggggaaccc gatccagatc gccgccgtgg tggtctggcg ggtggtggat       420
     gcggcccgcg ccctgttcga ggtcgacaag tacgaagagt tcgtcaagat ccagagcgag       480
     acggccctgc gccacatcgc cagccagtac ccctacgaca ccttcgagga tcacagcgcg       540
     acctcgctgc gcgagaacac cgacatcgtg tcccaggctc tggcccagga gctgcaggag       600
     cgcctggcgg tggccggggt cgaggtgctg gacgcccgcc tgacccacct ggcctacgcg       660
     ccggagatcg cccacgccat gctgcaacgg cagcaggctg aggcggtggt ggcggcccgg       720
     gcgaagatcg tggaaggggc cgtgggcatg gtgcagatgg ccctggcgga actgcagcgc       780
     cacggcgtgg tggaactgga cgacgagcgc cgggccgcca tgatcaacaa cctgatggtg       840
     gccatcgtcg gggagcgggc ggcgcaaccg gtgatcaaca ccggcacgct gtactga          897
//

If you have problems or comments...

PBIL Back to PBIL home page