(data stored in ACNUC30630 zone)

EMBL: CP002344.PE387

CP002344.PE387       Location/Qualifiers
FT   CDS_pept        454736..455065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0389"
FT                   /product="hypothetical protein"
FT                   /note="COGs: COG4877 conserved hypothetical protein; KEGG:
FT                   msv:Mesil_0344 hypothetical protein; SPTR: Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50512"
FT                   /db_xref="GOA:E6SG95"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG95"
FT                   /protein_id="ADU50512.1"
FT                   /translation="MQPGSGAAVRRPAGMTPASGREREVTLVPEKKRFLLRIDPVIYDA
FT                   IQRWAADEWRSVNGQIEYLLREALRRAGRLPAPVRGGRAQQDSGPPAGDSEGEGGSPPP
FT                   GTRGR"
     ttgcagcccg gcagcggggc ggcggtacgc cgccccgccg gcatgacgcc cgcctcggga        60
     cgggaacggg aagtgacgct cgtgccagag aagaagcggt ttctcctgcg catcgatccg       120
     gtgatctacg acgcgatcca gcggtgggcc gccgacgagt ggcgcagcgt caacggccag       180
     atcgagtacc tgctccggga ggcgctccgg cgggcaggcc ggctgcccgc accggtcagg       240
     gggggacggg cgcagcagga ttcgggaccg cccgcaggcg attccgaagg ggaaggggga       300
     tcgccgccac cagggacgcg tgggcggtga                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page