(data stored in ACNUC30630 zone)

EMBL: CP002344.PE39

CP002344.PE39        Location/Qualifiers
FT   CDS_pept        34474..35748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0039"
FT                   /product="phage major capsid protein, HK97 family"
FT                   /note="COGs: COG4653 phage phi-C31 gp36 major capsid-like
FT                   protein; InterPro IPR006444; KEGG: lga:LGAS_1485 phage
FT                   phi-C31 GP36 major capsid-like protein; SPTR: Phage major
FT                   capsid protein; TIGRFAM: phage major capsid protein, HK97
FT                   family; PFAM: Phage capsid family; TIGRFAM: phage major
FT                   capsid protein, HK97 family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50164"
FT                   /db_xref="InterPro:IPR024455"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKH7"
FT                   /protein_id="ADU50164.1"
FT                   /translation="MDLKELVGKARQRVEEARRIVEEYAGKAMPADVKEQVDRLLAEAK
FT                   ELKAQADRAAEVQKLQAWLDEPQYRRPMNEGAAKALAPEDEPAEDGGLSEAQKKKQTRA
FT                   FFKALRGGLGVLTREERELLNPARKGLVATKALVEDAAGEILVPEEVEAEIYRRLPKLT
FT                   VIRPLATVRTTGSNRVRRRSLTELQVGWGKLETGTALVQSTPQPGEEYTYVEDLYGLTL
FT                   VGEDELDDTDVNLTSFVADSFAQAIAEAEDTAFIAGTGHANQQPEGILNAADVPTVAAG
FT                   QTAAITTDDILTLIYKVPAQHRRNGVLIANPETVLRLRLLKTTDGQYLWQPSLVAGQPD
FT                   TFAGYPVYDSVDVPTIPTTAGQTNKVAIFGDVRSGYRILDRQGMTVKVLQERYADQGLI
FT                   GYRVRYRVGGSVVRPEAFAILTVAA"
     gtggatctga aggagttggt cgggaaggcc cggcagcggg tcgaggaagc ccgacgcatt        60
     gtcgaggagt acgcgggcaa ggcgatgccc gccgatgtca aggaacaggt agatcggctg       120
     ttggcggagg ccaaggaact gaaagcacag gccgaccggg cggcggaggt ccagaagctg       180
     caggcgtggc tggacgagcc ccagtaccgc cggcctatga acgagggcgc agccaaggcc       240
     cttgcgccgg aggacgagcc ggcggaggac gggggcctga gcgaggccca gaagaagaag       300
     cagacccggg cgttcttcaa ggctctgcgt ggtgggttgg gcgtattgac ccgcgaggag       360
     cgggagctgc tgaacccggc ccgcaagggg ctggtggcaa cgaaggcgct ggtggaggac       420
     gccgccggcg aaatcctggt gcccgaggaa gtggaggcgg agatctaccg gcggctgccc       480
     aagctgaccg tcatccggcc cctggcgacg gtccggacca ccgggtcaaa ccgggtacgc       540
     cgtcggagcc tgaccgaact gcaggtcggc tggggcaagc tggagaccgg cacggcgctg       600
     gtgcagtcca cgccgcagcc cggcgaggaa tacacctacg tcgaggacct gtacgggctg       660
     acgctggtcg gcgaggacga gctggatgac accgatgtca acctgacgtc gttcgtcgcc       720
     gattcgttcg cccaggccat cgcggaggcg gaagatacgg cgtttatcgc cggcaccggt       780
     cacgcgaacc agcagccgga gggcatcctc aatgccgcgg acgttccgac ggtagcggcg       840
     ggccagacgg cggccatcac caccgacgac atcctgacgc tgatctacaa ggtgcccgcc       900
     cagcaccgcc ggaacggcgt gctgatcgcc aaccccgaga cggtgctgcg gctgcggctg       960
     ctgaagacga ccgacggcca gtatctgtgg cagccgtccc tggtggccgg tcagccggac      1020
     accttcgcag gctatccggt ctacgactcg gtggacgttc cgaccatccc gaccaccgct      1080
     ggccagacca acaaggtcgc catcttcggt gacgtgcggt cgggctaccg tatcctggac      1140
     cgccagggta tgacggtcaa ggtcctgcag gagaggtacg cagaccaggg cctgatcggc      1200
     taccgcgtgc gctaccgggt tggtggcagt gtggtccggc cggaggcctt tgcgatcttg      1260
     acggtggcgg cgtag                                                       1275
//

If you have problems or comments...

PBIL Back to PBIL home page