(data stored in ACNUC30630 zone)

EMBL: CP002344.PE403

CP002344.PE403       Location/Qualifiers
FT   CDS_pept        477346..477990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0407"
FT                   /product="cytochrome c oxidase subunit III"
FT                   /note="COGs: COG1845 Heme/copper-type cytochrome/quinol
FT                   oxidase subunit 3; InterPro IPR000298; KEGG: svo:SVI_0007
FT                   cytochrome c oxidase subunit III; PFAM: cytochrome c
FT                   oxidase subunit III; SPTR: Cytochrome c oxidase subunit
FT                   III; PFAM: Cytochrome c oxidase subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50528"
FT                   /db_xref="GOA:E6SGB1"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGB1"
FT                   /protein_id="ADU50528.1"
FT                   /translation="MSTIEATQHPLAADQEAVLRSEWGGGRSPFATPHAKLGMWIFLAS
FT                   DVLVFATLLTAYGVARLKAGTWPDRTHIFEGLWLVTLMTFILISSSSTMAAAVGAARRG
FT                   DQKAAVRFLLLTILGGLFFLGSQAFEWTSLIREGARLMSNPWGVPQFSASFFVITGFHG
FT                   FHVLTGLIYLAVITLNAMRGRYSGLGVEVAGLYWHFVDLVWVFIFTLFYLI"
     atgagcacca tcgaagcgac gcagcacccg ctggccgccg atcaggaggc ggtgctgcgc        60
     tcggagtggg gcggcggccg ctcgcccttc gccacgcccc atgccaagct gggcatgtgg       120
     atcttcctgg cgtcggacgt gctggtcttc gccaccctcc tgacggcgta cggcgtggca       180
     cggctcaagg cggggacctg gccggaccgc acccacatct tcgaagggct gtggctggtc       240
     acgctgatga ccttcatcct gatcagcagc agctcgacca tggcggcggc ggtcggggcg       300
     gcccggcggg gcgatcagaa ggcggcggtg cggttcctgc tgctgaccat tctgggtggc       360
     ctgttcttcc tgggctcgca ggccttcgag tggaccagcc tgatccgcga aggcgcgcgg       420
     ctgatgtcca acccgtgggg cgtgccgcag ttcagcgcca gcttcttcgt gatcaccggc       480
     tttcacgggt tccacgtgct gaccggcctg atctacctgg cggtcatcac gctcaacgcc       540
     atgcggggcc ggtattcggg gctgggcgtc gaggtggcgg gtctgtactg gcacttcgtc       600
     gacctggtgt gggtgttcat cttcacgctg ttctacctga tctag                       645
//

If you have problems or comments...

PBIL Back to PBIL home page