(data stored in ACNUC30630 zone)

EMBL: CP002344.PE412

CP002344.PE412       Location/Qualifiers
FT   CDS_pept        complement(486387..487745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0416"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aac:Aaci_1480 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50537"
FT                   /db_xref="InterPro:IPR026838"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGJ1"
FT                   /protein_id="ADU50537.1"
FT                   /translation="MMPGRETAARRATVRELSHAAVPAWVQLGHAVIRLPSLWEPDQRT
FT                   LALPGAVLDAFGFDRGQAVYVFPADGGQRLVVGPLVGIWVTPAMLRSWKRGVRLLSQEV
FT                   RGAGGIPFFFDLKGVDRAGGRIRGWTWQGGRLRPVTIPLPDVIYNRATFPDPGPRAAAR
FT                   SLRRALWEEDAIPFVNLASGFPKWETYQALRFFADTRPLVPETVRLEAPAELAAFLSRH
FT                   RLVFVKADGGSHGTEVVRLRAVAGGWWIEGQVGRQRLRSRAADPAQVVEVLSRWIAGGV
FT                   WVVQQGIQLPRLNGRRWDLRVEVKKDGTGTWTVPLIVVRLGHPATVTTNISRGGTPFEL
FT                   EAFRRRFGPLPALAGLKAKATRVAVRVALALEARFGPLGEIGVDVGLDPQGRPWVFEAN
FT                   AKPQYGPSPRPEQARGLMAYAVQLALHAWAGREGGVNRPHPVASLQTFAGWAG"
     gtgatgccgg ggcgggagac ggccgctcgg cgcgccacgg tccgcgagct ctcccatgcc        60
     gccgtgccag cctgggtcca gctcggccac gccgtcatcc ggcttccgtc cctctgggaa       120
     cccgaccagc gcaccctggc cctgcctgga gcggtcctcg acgccttcgg tttcgaccgc       180
     gggcaggcgg tctacgtgtt ccctgccgac ggggggcagc gtctggtggt cggtcccctg       240
     gtcggcatct gggtcacccc ggcgatgctg cgctcctgga agcgaggcgt ccggctcctc       300
     agccaggagg tccgtggggc gggcggcatc cccttcttct tcgaccttaa gggcgtcgac       360
     cgcgccggcg gccgcatccg ggggtggacc tggcagggcg gaaggctccg gccggtcacc       420
     atacccctgc ccgatgtgat ctacaaccgg gcgacctttc ccgatcccgg cccccgggcc       480
     gccgcccggt cgctgcgcag ggcgttatgg gaggaagacg ccatcccctt cgtcaacctg       540
     gccagcgggt tccccaagtg ggagacctat caagccctgc gcttcttcgc cgacacccgc       600
     cccctggtcc cggagaccgt ccggctcgag gcaccggccg agctcgccgc cttcctctcc       660
     cgccaccgcc tggtcttcgt caaggccgac gggggcagtc acggcacgga ggtggtgcgg       720
     ttgcgggccg tcgcgggcgg gtggtggatc gagggacagg tcggccggca acggcttcgc       780
     agccgggcgg ccgatcccgc ccaggtggtg gaggtgctgt cgcgctggat cgcgggtggc       840
     gtctgggtgg tccagcaggg catccagctg ccgcggttga acggccgccg ttgggatctg       900
     cgcgtcgagg tgaagaagga cggcaccggt acgtggacgg tgccgctcat cgtcgtccgc       960
     ctgggtcacc cggcgacggt gaccaccaac atctcccgcg gcggcacgcc cttcgagctg      1020
     gaggcgtttc gccgccgctt cggtcccttg ccggcccttg ccggtctgaa ggccaaggcg      1080
     acccgcgtgg cggtccgggt cgccttggcg ctggaggcgc ggttcggccc gctcggcgag      1140
     atcggggtcg acgtcggcct cgatccccag ggccggccct gggtcttcga agccaacgcg      1200
     aagccccagt acggcccgtc cccgcggccc gagcaggccc ggggtctgat ggcctacgcc      1260
     gtccagctgg cgctgcacgc ctgggccggg cgggagggcg gcgtcaaccg cccgcacccc      1320
     gtggcgtcgc tccagacgtt cgccggctgg gctggatga                             1359
//

If you have problems or comments...

PBIL Back to PBIL home page