(data stored in ACNUC30630 zone)

EMBL: CP002344.PE425

CP002344.PE425       Location/Qualifiers
FT   CDS_pept        503204..503833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0429"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="COGs: COG0741 Soluble lytic murein transglycosylase
FT                   and related regulatory protein (some contain LysM/invasin
FT                   domains); InterPro IPR000189: IPR008258; KEGG:
FT                   mta:Moth_1837 lytic transglycosylase, catalytic; PFAM:
FT                   Lytic transglycosylase catalytic; SPTR: Lytic
FT                   transglycosylase, catalytic; PFAM: Transglycosylase SLT
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50550"
FT                   /db_xref="GOA:E6SGK4"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGK4"
FT                   /protein_id="ADU50550.1"
FT                   /translation="MTGVDLILGGGWPWLRWGAIALLAALVALAGFYAAYPVPMAELIG
FT                   QEAAACGVDPLLVAAVVRRESGFEPRAVSDRGARGLMQIMPETGAWVAGQMGLPAFHPD
FT                   RLFEPEYNLRLGCWYLAYLLERFHGDPVVALAAYNGGEGTVADWIARGRWHPQRGVSAI
FT                   PYPETRRFVAGVLRDYRVYQWLYRRLPDFWGQVRQLAAGALAGVRE"
     gtgacgggtg tggacctgat cctgggtggc gggtggccct ggctgcggtg gggggcgatc        60
     gccttgctgg cggcgctggt cgccctggcg gggttctacg ccgcgtaccc cgtgcccatg       120
     gccgagctca tcgggcagga ggcggcggcg tgcggggtcg accccttgct ggtggcggcg       180
     gtggtgcggc gggagagcgg gttcgagccg cgggcggtct ccgaccgcgg ggcccggggc       240
     ctgatgcaga tcatgcccga gaccggcgcc tgggtggccg ggcagatggg gctcccggcc       300
     tttcaccccg accggctctt cgagccggag tacaacctgc ggctggggtg ctggtacctc       360
     gcctacctcc tcgagcggtt ccacggcgac ccggtggtgg ccctggcggc ctacaacggc       420
     ggcgagggca cggtggcgga ctggatcgcc cgcggccgct ggcacccgca acgcggcgtg       480
     tccgccatcc cgtatccgga gacgcgccgt ttcgtcgcgg gcgtgctccg ggactaccgg       540
     gtctaccagt ggctctaccg gcgcttgccg gacttctggg ggcaggtgcg ccagctggcg       600
     gccggcgccc tggccggcgt ccgggagtag                                        630
//

If you have problems or comments...

PBIL Back to PBIL home page