(data stored in ACNUC30630 zone)

EMBL: CP002344.PE435

CP002344.PE435       Location/Qualifiers
FT   CDS_pept        complement(514802..516100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0439"
FT                   /product="signal transduction histidine kinase, LytS"
FT                   /note="COGs: COG3275 Putative regulator of cell autolysis;
FT                   InterPro IPR004358: IPR005467: IPR003018: IPR003594: IPR
FT                   010559; KEGG: adg:Adeg_1762 signal transduction histidine
FT                   kinase, LytS; PFAM: histidine kinase internal region; GAF
FT                   domain protein; ATP-binding region ATPase domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; GAF domain
FT                   protein; SPTR: Signal transduction histidine kinase, LytS;
FT                   PFAM: Histidine kinase; Histidine kinase-, DNA gyrase B-,
FT                   and HSP90-like ATPase; GAF domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50560"
FT                   /db_xref="GOA:E6SGL4"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGL4"
FT                   /protein_id="ADU50560.1"
FT                   /translation="MAGLGAVTAAAGYWWGSHAGWVAAALAGAAVTFGVAAGGAVLRRG
FT                   GLAERAEPDTGCWPPSPDLVTRTLPHLRHGLQPGTAQRVAEIVRCLTGADAVALSDRER
FT                   VLALAGAAARHHESCPPLAGTPAGSVVASGRPRTVAGEDGAGCPLGGTGCGCPLRSAVM
FT                   VPLQVRRRTVGTLQLLFTVPARPSRRTVDLARSVAQVLSLELELAWLAQQADLAAQARL
FT                   DALRAQINPHFLFNVLNTIIVKSRSDPEQARRLLVRLADFFRYAMRSRGHFASLSEEFA
FT                   FVRAYLFLEQARYEGRLRVRYQIDPQALAATVPVLTIQPLVENAVKHGIAPKPDGGLVE
FT                   LRIEADPLTLRLRITVADDGVGMDAHRLRQALERQSRGIGLANIRERLERLYGDQARCR
FT                   IQSQPGRGTRVQIELPLQAAAPTEVGEPGGTRT"
     gtggccggac tgggggcggt caccgcagcc gccggctact ggtggggttc ccacgcgggc        60
     tgggtggccg ccgccctggc gggcgcggcg gtgaccttcg gcgtcgccgc cggtggggcg       120
     gtcttgcggc gtggcggtct tgcggagcgg gcggaaccgg acaccggctg ctggccccca       180
     tcgcccgacc tggtgacccg gacgctcccc cacctgcggc acggtctgca acccggcacg       240
     gcacagcggg tcgccgagat cgtgcgttgc ctgaccggtg ccgacgccgt ggccctcagc       300
     gatcgagagc gggtgctggc cctggccggg gcggcggccc ggcaccacga gtcctgcccg       360
     ccgctggcgg gcacccccgc cggcagcgtc gttgcgtcgg gacggccccg aaccgtggcg       420
     ggggaggacg gcgccggttg ccccctgggc ggcacgggct gcgggtgccc cctccgctcc       480
     gccgtcatgg tccccttgca ggtccggcgg cgcacggtgg gcacgctgca gctgctcttc       540
     acggtgccgg cgcggccctc gcgccggacc gtggatctgg cgcggtccgt cgcgcaggtc       600
     ctcagcctgg aactggagct ggcgtggctg gcccagcagg ccgacctggc ggcccaggcg       660
     cgcctcgacg ccctgcgggc ccagatcaac ccgcacttcc tgttcaacgt gttgaatacc       720
     atcatcgtca agagccgcag cgatcccgag caggcccggc gcctgctggt ccggctcgcg       780
     gacttcttcc gttacgccat gcgctcccgg ggccacttcg cgagcctgag cgaggagttc       840
     gccttcgtcc gcgcctacct gttcctcgag caggcccggt acgagggccg cctgcgggtg       900
     cgttaccaga tcgaccccca ggccctggcg gcgacggtcc ccgtcctcac catccagccc       960
     ttggtggaaa acgccgtgaa gcacggcatc gccccgaagc cggatggcgg gttggtggag      1020
     ctgcggatcg aggcggaccc tctcaccctg cggctgcgaa tcaccgtggc ggacgacggc      1080
     gtcggcatgg acgcccacag gctgcgccag gccctggagc gacagtcccg gggcattggt      1140
     ctcgccaaca tccgggagcg ccttgagcgc ctctacggcg accaggcgcg ttgtcggatc      1200
     cagagccagc cgggacgagg aacccgggtg cagatcgagc tgccgctgca ggccgcggca      1260
     ccaacggagg tcggggagcc cggaggaacg aggacatga                             1299
//

If you have problems or comments...

PBIL Back to PBIL home page