(data stored in ACNUC30630 zone)

EMBL: CP002344.PE448

CP002344.PE448       Location/Qualifiers
FT   CDS_pept        complement(533079..534227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0452"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sth:STH1605 hypothetical protein; SPTR:
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50573"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGM7"
FT                   /protein_id="ADU50573.1"
FT                   /translation="MSVRHGRARHLFASGNTGHGFRSYFENVAWPEPRRVFVLKGGPGT
FT                   GKSAVIRLVADGLMERGVAVELFHCPSDPASLDGVNAPDLGLAVVDGTPPHAVEPPLPG
FT                   LVGRLLSLEATANRDLLASRRDHIAATGRRVRQRFHLAHRYLALALGALQLYEDFYDHA
FT                   GALDRAALDHSAHEIEAALFEGQRLVRAGRRGRVRRLFASAVTPDGPRHFLDSLLDPLP
FT                   RRVFIRGNPGTGCATLVERVAEAALRRGLDIEAYSCGLHGRRLDHVIIPELGAAVVHNA
FT                   YPHTYEPKAGDLVIDTAAFVDVDALERYREEMEVAQALFGQAFDQGIWYLRRALMAHQE
FT                   LEQVYATPELRTQVEAYTREILAEADALLEEQSRTREGQRLA"
     atgtcggtgc gtcacggacg ggcgcgtcac ctctttgcca gcggcaacac cggccacggg        60
     ttccgatcgt acttcgagaa cgtggcatgg cccgaacccc gccgcgtctt cgtgctcaag       120
     ggcgggccgg gcacgggcaa gtcggcggtc atccgcctgg tcgcggacgg gctgatggag       180
     cggggcgtgg cggtggaact cttccactgc ccgtcggacc ccgcctccct ggacggggtc       240
     aacgccccgg acctggggct ggcggtggtc gacggcacac caccccatgc ggtggagcct       300
     ccgctgcccg ggctggtggg gcggctgctc agcctggagg cgacggccaa ccgggacctc       360
     ctggcgtcgc ggcgggacca catcgccgcc accggccgcc gggtccgcca gcggttccat       420
     ctggcccacc gttacctggc cctcgccctg ggcgccttgc agctctatga agacttttac       480
     gaccacgcgg gggcgctgga ccgggcggcg ctggaccatt cggcccacga gatcgaggcg       540
     gccctcttcg agggccagcg gttggtgcgg gccgggcggc ggggccgggt gcgccggctc       600
     ttcgccagcg ccgtcacccc cgacggcccg cggcacttcc tggacagcct gctggacccg       660
     ctgccgcggc gcgtgttcat ccgcggcaac ccgggcacgg ggtgcgccac cctggtcgag       720
     cgggtggccg aagcggccct gcggcggggg ctggacatcg aggcctacag ctgcgggctg       780
     cacggccggc gcctggacca cgtcatcatc cccgaattgg gggcggcggt ggttcacaac       840
     gcctaccccc atacctacga gcccaaggcc ggcgacctgg tgatcgatac ggcggccttt       900
     gtcgacgtgg acgccctgga gcgctaccgg gaggagatgg aggtcgccca ggccctcttc       960
     ggccaggcct tcgaccaggg catctggtac ctgcgccgcg ccttgatggc ccatcaggag      1020
     ctggagcagg tctacgccac accggagctg cgcacccagg tggaggccta cacccgggag      1080
     atcctggccg aagccgacgc cctattggaa gaacagtccc ggacgcggga gggccagcgg      1140
     ctggcatga                                                              1149
//

If you have problems or comments...

PBIL Back to PBIL home page